KEGG   Streptomyces kanamyceticus: CP970_06690
Entry
CP970_06690       CDS       T06849                                 
Name
(GenBank) DegT/DnrJ/EryC1/StrS family aminotransferase
  KO
K20572  aminotransferase [EC:2.6.1.-]
Organism
ska  Streptomyces kanamyceticus
Pathway
ska00524  Neomycin, kanamycin and gentamicin biosynthesis
ska01110  Biosynthesis of secondary metabolites
ska01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CP970_06690
Enzymes [BR:ska01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     CP970_06690
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_5
Other DBs
NCBI-ProteinID: QEU90636
UniProt: A0A5J6GBI9
Position
1718489..1719748
AA seq 419 aa
MSKKLALFGGTPVRNEEFYDGPHIGPHDLDRLKSVLDSGNFGGIPFPNTHHTAFADLFTG
KLGAPYGLMVSNGTISLSIALRALGVRAGDEVITTGYTWMGTAAAIVHINAVPVLVDIDP
TTWCIDPAAVEAAITPRTKVIVPVHLGNQIADLDALRAIADKHGLAILEDTAHGHFAEWR
GQCVGTHGDAGSFSFESSKIMTAGEGGFLVARDEDVYQRMMSLANCGRKEPGYDGFAGRT
LGWNARASELQAAFMIGQVEQHDALHAKRAASAAKLTAGLAEIGGFTPVGNDDPRITRRQ
YYEVIYRFDPAAWEGLHRDEVLSAILAEGIELEGDAFYPPVHKSELFAVDAVHWPMIAER
YGDRIGPDSVDLPVADRAAADESVWVHHALLTGDDKDLGDILEAVAKVRDNLRELHDAS
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaagaagctggcgctgttcggcggaactcccgtacggaacgaggagttctacgac
ggcccgcacatcgggccgcacgatctcgaccgcctcaaatccgtcctcgactcggggaac
ttcggcggcatccccttccccaacacccaccacaccgccttcgccgacctgttcaccggc
aagctcggcgccccgtacggcctgatggtctccaacggcaccatcagtctctccatcgcg
ctgcgcgccctgggcgtgcgtgccggggacgaggtgatcaccaccggctacacctggatg
ggcacggccgcggcgatcgtgcacatcaacgccgtccccgtcctggtggacatcgacccc
acgacctggtgcatcgacccggcggcggtggaggcggcgatcaccccgcgcaccaaggtg
atcgtcccggtccatctgggcaatcagatcgccgacctcgacgcgctgcgggcgatcgcc
gacaagcacggactcgcgatcctggaggacaccgcgcacgggcacttcgccgagtggcgg
gggcagtgcgtgggcacccacggggacgcgggcagcttcagcttcgagagcagcaagatc
atgactgccggtgagggcggcttcctggtggccagggacgaggacgtgtaccagcggatg
atgtcgctggccaactgcggccgcaaggagccgggttacgacggtttcgcgggccgcacc
ctgggctggaacgcccgcgcgagcgaactgcaggccgccttcatgatcgggcaggtcgag
cagcacgacgcgctgcacgccaagcgggcggcgagcgcggcgaagctcaccgcggggctc
gccgagatcggcggcttcactcccgtggggaacgacgacccgaggatcacccggcgccag
tactacgaggtcatctaccgcttcgaccccgccgcctgggaggggctgcaccgggacgag
gtcctctcggcgatccttgccgagggcatcgagctggagggcgacgccttctacccgccc
gtacacaagagcgaactgttcgcggtggacgccgtccactggcccatgatcgccgagagg
tacggcgatcggatcggcccggacagcgtcgacctgcccgtcgccgaccgcgccgccgcc
gacgagtccgtgtgggtgcaccacgcgctgctcaccggcgacgacaaggacctcggcgac
atcctcgaagccgtcgccaaggtccgcgacaacctgcgagaactgcacgacgcgagctga

DBGET integrated database retrieval system