KEGG   Streptomyces kanamyceticus: CP970_39725
Entry
CP970_39725       CDS       T06849                                 

Definition
(GenBank) class I SAM-dependent methyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
ska  Streptomyces kanamyceticus
Pathway
ska00523  Polyketide sugar unit biosynthesis
ska01100  Metabolic pathways
ska01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CP970_39725
Enzymes [BR:ska01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     CP970_39725
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_2 MetW NodS Ubie_methyltran DUF938 Methyltransf_15 CMAS
Other DBs
NCBI-ProteinID: QEU96253
UniProt: A0A5J6GME7
Position
complement(9141458..9142186)
AA seq 242 aa
MYGTEASEIYELLHQGKGKDYGDEAEEIAWRVRTLLPNADSLLDVACGTGAHLQHFRKEF
ARVEGLELSEPMAAAARRRLPGVSVHGGDMRDFAIGASYSAITCMFGSIGYLADTAELNA
ALRRFARHLVPGGVVAIDPWWFPDTFLDGYVSSGTATARGRTLARVSHAVRAGNASRMEV
HYLVADAESGVRHFDETHLITLFTREQYEAAFTGAGLTVEYTPELHGGRGLFTGALTRPR
AA
NT seq 729 nt   +upstreamnt  +downstreamnt
ttgtacggcacggaagccagcgagatctacgaactgctgcaccagggcaagggcaaggac
tacggcgacgaggcggaggagatcgcctggcgcgtcaggaccctgctcccgaacgccgat
tcgctgctcgacgtggcctgcggcaccggcgcccatctccagcacttccgcaaggagttc
gcccgcgtcgagggcttggagctgtccgagccgatggccgcggccgcgcgtcggcggctc
cccggagtgagcgtgcacggcggcgacatgcgcgacttcgcgatcggcgcctcctactcc
gcgatcacctgcatgttcggctcgatcggctatctcgccgacaccgccgaactgaacgcc
gcgctccgccggttcgcccggcacctggtccccggcggggtggtcgcgatcgacccctgg
tggttccccgacacgttcctcgacggctatgtgtcgagcggcaccgccaccgcgcggggc
aggacgctggcccgggtgtcacacgcggtgcgcgcggggaacgcgtcacggatggaggtg
cactacctcgtcgcggacgcggagtcgggtgtccggcacttcgacgagacgcatctgatc
acgctgttcacccgtgagcagtacgaagcggcgttcaccggggccggtctcaccgtcgag
tacacccccgaactgcacggcggccggggcctgttcacgggtgcgctcacccggccccgc
gccgcctga

DBGET integrated database retrieval system