KEGG   Streptomyces kanamyceticus: CP970_39840
Entry
CP970_39840       CDS       T06849                                 

Definition
(GenBank) SnoaL/DnrD family polyketide biosynthesis methyl ester cyclase
  KO
K15943  nogalonic acid methyl ester cyclase / aklanonic acid methyl ester cyclase [EC:5.5.1.26 5.5.1.23]
Organism
ska  Streptomyces kanamyceticus
Pathway
ska01057  Biosynthesis of type II polyketide products
ska01100  Metabolic pathways
ska01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP970_39840
Enzymes [BR:ska01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.23  aklanonic acid methyl ester cyclase
     CP970_39840
    5.5.1.26  nogalonic acid methyl ester cyclase
     CP970_39840
SSDB
Motif
Pfam: SnoaL SnoaL_2 PHZA_PHZB
Other DBs
NCBI-ProteinID: QEU97858
UniProt: A0A5J6GVN8
Position
9168506..9168940
AA seq 144 aa
MSHQIDAVRRVINAFNTGEADDAGEYLHEEYLNPATQEHGIPPGPAGFGMIVKWVRMTFS
DEAHLEEVRIEEKGEWVRAYLVLYGRHVGNLVGFAPTGRKFAGEQVHLFRFVDGKIRDHR
DWPEFQSTLRQLGEPWPEAGGWRP
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagccatcaaatagatgccgtacgacgagtgatcaacgccttcaacaccggagaggcc
gacgacgcgggcgagtacctccacgaggagtacctgaacccggccacgcaggagcacggc
attccgccgggccccgccgggttcggcatgatcgtcaagtgggtgcggatgaccttctcc
gacgaggcccacctcgaagaggtcaggatcgaggagaagggcgagtgggtccgcgcctac
ctggtgctctacggacggcacgtcggaaacctcgtcggcttcgcccccaccggccgtaag
ttcgcgggcgagcaggtccacctcttccgcttcgtcgacgggaagatccgggaccaccgg
gactggccggagttccagagcaccttgcgccagctcggcgagccgtggccggaggcgggc
ggctggcgcccgtag

DBGET integrated database retrieval system