KEGG   Streptomyces kanamyceticus: CP970_39870
Entry
CP970_39870       CDS       T06849                                 

Definition
(GenBank) class I SAM-dependent methyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
ska  Streptomyces kanamyceticus
Pathway
ska00523  Polyketide sugar unit biosynthesis
ska01100  Metabolic pathways
ska01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CP970_39870
Enzymes [BR:ska01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     CP970_39870
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 NodS Ubie_methyltran NNMT_PNMT_TEMT Methyltransf_2 Methyltransf_15 MetW CMAS
Other DBs
NCBI-ProteinID: QEU96277
UniProt: A0A5J6GM05
Position
complement(9174723..9175433)
AA seq 236 aa
MYGQELAKVYEIFYRSRGKDWTAEAEEVTRLVRARMPEAGTLLDVACGTGAHLATFREQF
DTVEGLEIAPSMLELARQRLPGLTFHDGDMRDFALEDTFDAVVCMFCAIGYLGTVEELRA
AVRAMSDHLSPGGVLVIEPWWFPEDHVEGYVAGDLGKEDGLTVARISHSTRQGRATRMEV
RFLVGESAGIKEFTEIDVLTLFTRDEYTQAFLDADCSVEYLPGAPTGRGLFVGIRH
NT seq 711 nt   +upstreamnt  +downstreamnt
atgtacgggcaggaactcgccaaggtctacgagatcttctaccgcagccgcggcaaggac
tggaccgccgaggccgaagaggtcacccggctcgtccgggcccgcatgcctgaggccggc
accctgctggacgtggcctgcggcaccggcgcccatctggccaccttccgcgagcagttc
gacacggtggagggcctggagatcgctccctcgatgctggagctcgcacgccagcggctg
cccggactgaccttccacgacggcgacatgcgcgacttcgcgctcgaggacaccttcgac
gcggtcgtctgcatgttctgcgcgatcggctatctcggcacggtcgaggagctgcgggcc
gcggtgcgcgcgatgtcggaccacctctcccccggcggagtgctggtgatcgagccgtgg
tggttccccgaggaccacgtcgagggatacgtcgcgggcgacctcggcaaggaggacggg
ctcaccgtcgcccggatctcgcactccacgcgccagggccgggccacccgcatggaggtg
cgcttcctggtcggcgagagcgccgggatcaaggagttcaccgagatcgacgtgctgacc
ctgttcaccagggacgagtacacccaggcgttcctcgacgccgactgttccgtcgaatac
ctgcccggcgcgcccaccggccgggggctgttcgtcggtatccgtcattga

DBGET integrated database retrieval system