Stenotrophomonas sp. LM091: BIZ42_00720 Help Entry BIZ42_00720       CDS       T04630                                  Name (GenBank) thiol reductase thioredoxin   KO K03671   thioredoxin Organism slm  Stenotrophomonas sp. LM091 Brite KEGG Orthology (KO) [BR:slm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:slm03110]     BIZ42_00720 Chaperones and folding catalysts [BR:slm03110]  Protein folding catalysts   Protein disulfide isomerase    BIZ42_00720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 AhpC-TSA Thioredoxin_7 TraF DUF2752 TXNDC16_N HyaE Motif Other DBs NCBI-ProteinID:  AOX60856 Position 168971..169294 Genome browser AA seq 107 aa AA seqDB search MLTLHARTAEDYHAALREHPALLVDFHKDDCPGCRMLEMSLASVSGAIAEAGMTVLKVKL ETVGEGLFRELGLRQTPTLLVVRDGHETARLAGFQTPKQILAVLGDG NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgctgaccctgcacgcccggaccgctgaggattaccacgccgccctgcgcgaacaccct gcgctgctggtggacttccacaaggacgattgccccgggtgccggatgctggagatgtcg ttggccagtgtctccggcgccatcgcggaggccgggatgacagtgttgaaggtgaagctg gaaaccgtgggtgagggcttgttccgcgagctggggttgcgccagacaccgacgctgctg gtggtgcgcgacggtcacgaaaccgcccgactggcggggttccagacgccgaagcagatc ctggcggtgttgggcgatgggtga

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (8) Pfam (8) All databases (10) Download RDF

DBGET integrated database retrieval system