KEGG   Solanum lycopersicum (tomato): 101251277
Entry
101251277         CDS       T02665                                 

Definition
(RefSeq) premnaspirodiene oxygenase
  KO
K15472  premnaspirodiene oxygenase [EC:1.14.14.151]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00909  Sesquiterpenoid and triterpenoid biosynthesis
sly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    101251277
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sly00199]
    101251277
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.151  premnaspirodiene oxygenase
     101251277
Cytochrome P450 [BR:sly00199]
 Cytochrome P450, plant type
  CYP71 family
   101251277
Motif
Pfam: p450 Actin_micro
Other DBs
NCBI-GeneID: 101251277
NCBI-ProteinID: XP_004237369
UniProt: A0A3Q7GCX2
Position
4
AA seq 501 aa
MPFLSLASVFLFLSFLFLLRKWKNSNSQSKKLPPGPWKLPLLGSMLHMVGGLPHHVLRDL
AKKYGPLMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYSRSDIAFCP
YGDYWRQMRKICVLELLSAKNVRSYSSIRRDEVDRLVNFIRSSSSFREPVNFTERLFLFT
SSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIVNAHH
KVDAIVEDVINEHKKNIAMGKTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIFDM
FAAGTETSSSTLVWAMVQLMKNPSVFAKAQAEVREAFKDRETFDENDVEELKYLKLVIKE
TLRLHPPVPLLVPRECREETDINGYTVPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQ
SSVDFIGNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPNGMEPKDLNLTE
LVGVTAARKDDLILVATPYQQ
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgccattcttgagcttggcttccgttttcctttttctatcttttctgtttttgttaagg
aaatggaaaaactcgaatagccaatcgaaaaaattgcctccaggtccatggaaacttcct
ttactaggaagtatgcttcatatggttggtggacttccacaccatgttcttagagattta
gcgaaaaaatatggaccacttatgcatcttcagcttggtgaagtctctgctgttgttgtt
acttctcctgatatggcgaaagaagtactgaaaactcatgacatcgcttttgcatctagg
cctaagctcttggccccggagattgtttgttacagcaggtctgatattgcgttttgcccc
tatggagattactggaggcaaatgcgtaaaatttgtgtcttggaattgttgagtgccaag
aatgtccggtcatacagctctattaggcgcgatgaggttgatcgtcttgttaattttatc
aggtcatcttcgtcttttcgtgagccggttaattttactgaaaggttgtttttgttcaca
agttccatgacatgtagatcagcatttgggaaagtgtttaaagaacaggacaaatttata
caactaatcaaagaggtgattgggttagcaggaggattcgatgtggctgatatcttcccg
tcgttgaagtttctccatgtgcttagtggcatgaaaggtaaaatagtgaatgctcatcat
aaggtagatgcaattgttgaagatgtaatcaatgagcacaagaagaacattgcgatgggg
aaaactaatggtgcattaggtggtgaagatctaattgatgttcttttaagacttatgaat
gatggaggccttcaatttccgatcaccaacgacaacatcaaagctattattttcgacatg
tttgctgcgggaacagagacttcatcgtcaacactagtgtgggcaatggtgcaactgatg
aaaaatccaagtgtattcgccaaagctcaagcagaggtgcgagaagcctttaaagacaga
gaaacgttcgatgaaaatgatgtggaggagctgaaatacttgaagttagtcataaaagaa
acgctaagactccatccaccagttccacttttagtcccaagagaatgcagggaagagacg
gatataaacggttacactgttcctgtgaagaccaaagtcatggtcaatgtttgggcattg
ggaagagatccgaaatattgggatgatgcagaaagctttaagccagagagatttgagcag
agctctgtagactttattggtaacaatttcgagtatcttccgtttgggggtgggagaagg
atttgtcccgggatatcatttggtttagctaatgtttatttaccgttggctcaattgtta
tatcacttcgactggaaactccctaatggaatggagccaaaagacttgaatttgactgaa
ttggttggagtaactgctgccagaaaagatgaccttattttggttgccacaccttatcaa
caatga

DBGET integrated database retrieval system