KEGG   Solanum lycopersicum (tomato): 543549
Entry
543549            CDS       T02665                                 
Symbol
SSTLE1
Name
(RefSeq) germacrene C synthase
  KO
K15802  germacrene C synthase [EC:4.2.3.60]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    543549 (SSTLE1)
Enzymes [BR:sly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.60  germacrene C synthase
     543549 (SSTLE1)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2
Other DBs
NCBI-GeneID: 543549
NCBI-ProteinID: NP_001234055
UniProt: O64961
Position
6:37940028..37943039
AA seq 548 aa
MAASSADKCRPLANFHPSVWGYHFLSYTHEITNQEKVEVDEYKETIRKMLVETCDNSTQK
LVLIDAMQRLGVAYHFDNEIETSIQNIFDASSKQNDNDNNLYVVSLRFRLVRQQGHYMSS
DVFKQFTNQDGKFKETLTNDVQGLLSLYEASHLRVRNEEILEEALTFTTTHLESIVSNLS
NNNNSLKVEVGEALTQPIRMTLPRMGARKYISIYENNDAHHHLLLKFAKLDFNMLQKFHQ
RELSDLTRWWKDLDFANKYPYARDRLVECYFWILGVYFEPKYSRARKMMTKVLNLTSIID
DTFDAYATFDELVTFNDAIQRWDANAIDSIQPYMRPAYQALLDIYSEMEQVLSKEGKLDR
VYYAKNEMKKLVRAYFKETQWLNDCDHIPKYEEQVENAIVSAGYMMISTTCLVGIEEFIS
HETFEWLMNESVIVRASALIARAMNDIVGHEDEQERGHVASLIECYMKDYGASKQETYIK
FLKEVTNAWKDINKQFFRPTEVPMFVLERVLNLTRVADTLYKEKDTYTNAKGKLKNMINS
ILIESVKI
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggctgcttcttctgctgataagtgtcgccccttggctaattttcacccatctgtttgg
ggatatcatttcctttcttatactcatgaaattactaatcaagaaaaagttgaagttgat
gagtacaaagagacaattagaaaaatgctggtggaaacttgcgacaatagcactcaaaag
cttgtgttgatagacgcgatgcaacgattgggagtggcttatcatttcgataatgaaatt
gaaacatccattcaaaacatttttgatgcatcgtccaaacagaatgataatgacaacaac
ctttacgttgtgtctcttcgttttcgacttgtgaggcaacaaggccattacatgtcttca
gatgtgttcaagcaattcaccaaccaagatgggaaattcaaggaaacacttactaatgat
gtccaaggattattgagtttgtatgaagcatcacatctgagagtgcgtaatgaggagatt
cttgaagaagctcttacatttaccaccactcatctcgagtctattgtctccaacttgagc
aataataataactctcttaaggttgaagttggtgaagccttaactcagcctattcgcatg
actttaccaaggatgggagctagaaaatacatatccatttacgaaaacaatgatgcacac
caccatttgcttttgaaatttgctaaattggattttaacatgctgcaaaagtttcaccaa
agagagcttagtgatcttacaaggtggtggaaagatttggattttgcaaataaatatcca
tatgcaagagacaggttggttgagtgttacttctggatattaggagtgtattttgagcca
aaatatagtcgtgcgagaaaaatgatgacaaaagtactcaacctgacctccattattgac
gacacttttgatgcttatgcaacctttgacgaacttgtgactttcaatgatgcaatccag
agatgggatgctaatgcaattgattcaatacaaccatatatgagacctgcttatcaagct
cttctagacatttacagtgaaatggaacaagtgttgtccaaagaaggtaaactggaccgt
gtatactatgcaaaaaatgagatgaaaaagttggtgagagcctattttaaggaaacccaa
tggttgaatgattgtgaccatattccaaaatatgaggaacaagtggagaatgcaatcgta
agtgctggctatatgatgatatcaacaacttgcttggtcggtatagaagaatttatatcc
cacgagacttttgaatggttgatgaatgagtctgtgattgttcgagcttccgcattgatt
gccagagcaatgaacgatattgttggacatgaagatgaacaagaaagaggacatgtagct
tcacttattgaatgttacatgaaagattatggagcttcaaagcaagagacttacattaag
ttcctgaaagaggtcaccaatgcatggaaggacataaacaaacaattcttccgtccaact
gaagtaccaatgtttgtccttgaacgagttctaaatttgacacgtgtggctgacacgtta
tataaagagaaagatacatatacaaacgccaaaggaaaacttaaaaacatgattaattca
atactaattgaatctgtcaaaatataa

DBGET integrated database retrieval system