KEGG   Solanum lycopersicum (tomato): 543675
Entry
543675            CDS       T02665                                 

Symbol
DES
Name
(RefSeq) 9-divinyl ether synthase
  KO
K17874  9-divinyl ether synthase [EC:4.2.1.121]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sly00199]
    543675 (DES)
Enzymes [BR:sly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.121  colneleate synthase
     543675 (DES)
Cytochrome P450 [BR:sly00199]
 Cytochrome P450, plant type
  CYP74 family
   543675 (DES)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 543675
NCBI-ProteinID: NP_001234527
UniProt: Q9FPM6
Position
1
AA seq 478 aa
MSSYSELSNLPIREIPGDYGFPIISAIKDRYDYFYNQGEDAWFHNKAEKYKSTVVKINMA
PGPFTSNDYKLVAFLDANSFVCMFDNSLIDKTDTLGGTFKPGKEYYGGYRPVAFIDTKDP
NHAALKGYILSSFAKRHNLFIPLFRNTLSDHLFNNLEKQVTEQGKADFNALLPTMTFDFI
FRLLCDQKNPSDTVLGAQGPEHLRKWLFPQLIPSLSAKKLPNIIEDMLFHNFLIPFGFIK
SDYNKLVDAFSKSAVSMLDEAEKLGIKREEAVQNILFLVGINMFAGLNAFFPHLFRFVGE
AGASLHTQLAKEIRSVIKEEGGAITLSAINKMSLVKSVVYETLRLRPPVPLQYGKAKKEF
MVQSHDASYKINKGQFVVGYQPMASRDPKIFANPDEFVPDRFMNDGEKMLKHVLWSNGRE
TESPAPDNKQCPGKDLVHLLGRLILVEFFIRYDTFTLEITPLFRAPNVAFNTLTKASK
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcttcttattcagagctatcaaatcttccgattcgtgaaattccaggggactatggt
ttccctataattagcgcgattaaagatcgatacgattatttctataaccaaggtgaagat
gcttggttccataacaaagctgaaaaatacaaatctactgttgtcaaaatcaacatggca
ccaggtccattcacatctaatgactacaaattggtagcctttttagatgccaatagcttt
gtttgcatgtttgataattccctcattgataaaactgacactcttggtggtacatttaag
cctggtaaagaatactacggtggttatcgtcccgtcgcgtttatcgataccaaagatcca
aaccacgcagcattaaaaggctacattttatcatcattcgcaaagcgacataacttattc
attcctctgttcagaaacacgttatccgatcatctttttaataatctcgaaaaacaggtt
actgaacaggggaaagcagatttcaatgctttgcttccgactatgacgtttgatttcatt
tttcgtttgctttgtgatcagaaaaatccgtctgatacagttcttggcgctcaaggacca
gaacatctacgtaaatggcttttcccacagctaattccgtccttgagcgccaagaaactt
cctaacatcatagaagatatgctcttccataattttttaataccatttggttttataaag
agtgattacaacaaacttgttgatgcatttagcaagtctgctgtgtccatgttggatgaa
gcagaaaaacttggaatcaaaagagaagaagctgtacaaaacattctttttctcgtgggg
atcaatatgtttgcggggctgaacgcctttttccctcatctattcaggtttgtgggcgaa
gcaggggctagtctacacacacaacttgctaaagaaatcaggagtgttattaaagaagaa
ggtggtgcaatcacattatcagcgattaacaaaatgagtttggtcaaatcggtagtgtac
gagacattgagacttcgcccaccagtaccattacagtatggtaaggcgaagaaagagttc
atggttcaaagccacgatgcatcttacaagatcaataaaggacaattcgtagttggatat
cagcccatggctagtagggaccctaagattttcgcaaacccggatgagtttgtacctgat
aggttcatgaatgatggtgagaaaatgctgaaacatgtcctatggtctaatggaagggaa
acagagagtccagcaccagataacaagcaatgtccaggcaaagatttggtgcacctattg
ggtaggttaatattggttgaatttttcatcagatacgatacattcaccctggaaattaca
cctctatttcgtgcaccaaatgttgcgttcaacacattaactaaagcaagtaaatag

DBGET integrated database retrieval system