KEGG   Streptomyces avermitilis: SAVERM_1138
Entry
SAVERM_1138       CDS       T00126                                 

Symbol
rnhA
Name
(GenBank) putative ribonuclease H
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_1138 (rnhA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_1138 (rnhA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     SAVERM_1138 (rnhA)
DNA replication proteins [BR:sma03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    SAVERM_1138 (rnhA)
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     SAVERM_1138 (rnhA)
   Elongation factors (archaeal)
     SAVERM_1138 (rnhA)
SSDB
Motif
Pfam: RNase_H Fungal_KA1 RVT_3
Other DBs
NCBI-ProteinID: BAC68848
NITE: SAV1138
UniProt: Q79ZK0
Position
complement(1426227..1426937)
AA seq 236 aa
MIGGMSERVVAACDGASKGNPGPAGWAWVVADGEETPTRWAAGALGTATNNVAELTALER
LLSAMDPDVPLEIRMDSQYAMKAVTTWLPGWKRKGWKTAAGKPVANQELVARIDELLDGR
SVEFRYVPAHQVDGDRLNDFADRAASQAAIVQEPAGSEYGSPEPPKSPDTVAAGSAGRGA
PAKKRASARTAKTSTRTIKAKFPGRCVCGRPYAAGEPIAKNAQGWGHPECRTADDV
NT seq 711 nt   +upstreamnt  +downstreamnt
atgatcgggggcatgtctgaacgtgtggtggccgcctgtgacggggcgtcgaagggaaac
cccggaccggccggatgggcctgggtcgtcgccgacggcgaggagaccccgacccgctgg
gcggccggggcgctcggcacggccacgaacaacgtggccgaactcaccgcgctggagcgc
ttgttgagcgcgatggatccggacgtcccgctggagatccggatggactcccagtacgcg
atgaaggccgtcacgacctggctgcccggctggaagcgcaagggctggaagacggccgcg
gggaagccggtcgccaaccaggaactggtcgcccgcatcgacgaactgctcgacggacgc
tccgtcgagttccgttacgtccccgcgcaccaggtcgacggcgaccggctcaacgacttc
gccgaccgtgccgccagccaggcggcgatcgtccaggaaccggcgggcagcgagtacggc
tccccggagccgccgaagtcgcccgacaccgtcgcggccggctccgcgggtcgcggcgct
cccgccaagaagcgtgcctccgcgcgcaccgccaagacgagcacgcgcacgatcaaggcg
aagttccccggccgctgtgtctgcggccgcccctacgcggcgggcgagcccatcgccaag
aacgcgcagggctggggccacccggagtgccgtaccgccgacgacgtctag

DBGET integrated database retrieval system