KEGG   Streptomyces avermitilis: SAVERM_1274
Entry
SAVERM_1274       CDS       T00126                                 
Symbol
pvdS
Name
(GenBank) putative regulatory protein
  KO
K22468  polyphosphate kinase [EC:2.7.4.34]
Organism
sma  Streptomyces avermitilis
Pathway
sma00190  Oxidative phosphorylation
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_1274 (pvdS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_1274 (pvdS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_1274 (pvdS)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.34  GDP-polyphosphate phosphotransferase
     SAVERM_1274 (pvdS)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     SAVERM_1274 (pvdS)
SSDB
Motif
Pfam: PPK2
Other DBs
NCBI-ProteinID: BAC68984
NITE: SAV1274
UniProt: Q82NM8
Position
1581753..1582556
AA seq 267 aa
MAGKKTARVPRAAYEQELLRLQTELVKLQEWVRAEGARLVIVFEGRDAAGKGSTIKRVAE
HLNPRQARIVALPKPTERERTQWYFQRYVEHLPAAGEIVLFDRSWYNRAGVEHVMGFCTK
EEHQLFLRQCPIFERMLVEEGILLRKYWFSVSDAVQQERFRRRMKDPTRRWKLSPMDLES
ITRWEAYSRAKDEMLVHTDISEAPWFVVESDDKRRARLNMMAHLLGSVPYYEVPPPVLEL
PRRPPSTGYERPPRDLQTYVPDHAASL
NT seq 804 nt   +upstreamnt  +downstreamnt
atggccggcaagaagacggcgagggtgccgcgcgccgcatacgagcaggaactgctgcgc
ctgcagaccgagttggtgaagctgcaggaatgggtgcgggcggagggcgcccgtctggtc
atcgtgttcgagggccgggacgcggccggcaagggcagcacgatcaaacgggtggcggaa
catctcaatccgcggcaggcacggatcgtggcgctgccgaagccgaccgagcgtgagcgc
acccagtggtatttccagcggtacgtcgagcatctgccggccgccggggagatcgtgttg
ttcgaccggagctggtacaaccgcgccggtgtcgagcacgtcatgggtttctgcaccaag
gaggagcaccagctcttcctgcggcaatgtccgatcttcgaacggatgctggtcgaggag
gggatcctgctgcgcaagtactggttctcggtgagcgacgccgtgcagcaggagcggttc
cggcgccggatgaaggatccgacgcggcgctggaagctctcgccgatggacctggagtcg
atcacccgctgggaggcctactcgcgggcgaaggacgagatgctcgtccatacggacatc
tcggaggctccgtggttcgtcgtggagagcgacgacaagcggcgggcgcggctgaacatg
atggctcatctgctcggctccgtgccctactacgaggttccgccgccggtcctcgaactg
ccgcgccgcccgccgtcgaccggctacgagcgaccgccacgcgatctgcagacctacgtg
cccgaccacgcggcgagcctctga

KEGG   Streptomyces avermitilis: SAVERM_4069
Entry
SAVERM_4069       CDS       T00126                                 
Symbol
ppk
Name
(GenBank) putative polyphosphate kinase
  KO
K00937  polyphosphate kinase [EC:2.7.4.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00190  Oxidative phosphorylation
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_4069 (ppk)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_4069 (ppk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_4069 (ppk)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.1  ATP-polyphosphate phosphotransferase
     SAVERM_4069 (ppk)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     SAVERM_4069 (ppk)
SSDB
Motif
Pfam: PP_kinase_C_1 PP_kinase PP_kinase_C PP_kinase_N PLDc_2
Other DBs
NCBI-ProteinID: BAC71781
NITE: SAV4069
UniProt: Q82G29
Position
4987758..4990112
AA seq 784 aa
MPEPSPPPVNGESKRTGRQVVALPPARSDAPFPRPARKNGAMSQPNVQAQVQHPQPSVGS
IAAHRPHTVAAAVSDLEPDLDADLDAYEDTDADGVQLPQGRFLDRERSWLAFNERVLELA
EDPNTPLLERANFLAIFASNLDEFFMVRVAGLKRRIATGVATRSASGLQPREVLEMIWAR
SRELMARHAACYQEDVAPALAEEGIHLVRWNELTEKEQARLFTLFRHQIFPVLTPLAVDP
AHPFPYISGLSLNLAVVVRNPVSGHRHFARVKVPPLLSRFLEASPDRYVPIEDVIAAHLE
ELFPGMEVLEHHTFRLTRNEDLEVEEDDTENLLQALEKELMRRRFGPPVRLEVEESIDRH
VLDLLVRELKVSEAEVYPLPGPLDLTGLFGIGALDRPELKYPKFIAGTHRDLAEVESASA
PDIFAALRERDVLLHHPYDSFSTSVQAFLEQAAGDPDVLAIKQTLYRTSGDSPIVDALIE
AAEAGKQVLVLVEIKARFDEQANIKWARKLEESGCHVVYGLVGLKTHCKLSLVVRQEGET
LRRYCHVGTGNYHPKTARLYEDLGLLTADPQVGADLSDLFNRLSGYSRRETYRRLLVAPK
SLRDGLVSRINKEIQHHQAGRPAFVRIKVNSMVDEAIIDALYRASQAGVPVDVWVRGICA
VRPGVTGMSENIRVRSILGRFLEHSRVFTFGNGGEPEVWIGSADMMHRNLDRRIEALVRV
TDPAHRAALNRLLETGMSDTTASWHLGPDGEWTRHATDAEGQPLRNVQEMLIDARRRRRG
TATP
NT seq 2355 nt   +upstreamnt  +downstreamnt
gtgcccgagccctcgccgcctccggtgaacggggagagcaagcgaaccggccgccaggtc
gtcgcgctcccgcccgctcgctctgacgcgcccttcccccgcccggcgcggaagaatggg
gccatgagccagccaaatgtccaggcacaggtccagcacccgcagccctccgtggggtcc
atcgccgcgcaccgcccgcacaccgtggccgccgcggtctccgacctggagcccgacctc
gatgccgacctcgacgcgtacgaggacaccgacgccgacggcgtccagctcccgcagggc
cgcttcctcgaccgggagcgcagctggctcgcgttcaacgagcgcgtcctcgagctcgcc
gaggacccgaacacgcccctcctcgagcgggcgaacttcctggcgatcttcgccagcaac
ctcgacgagttcttcatggtgcgggtggcgggactgaagcgccgcatcgccaccggcgtc
gccacccgctccgcctccggtctccagccccgcgaggtcctggagatgatctgggcccgc
tcccgcgagctgatggcccggcacgccgcctgctaccaggaggacgtcgcccccgcgctg
gcggaggagggcatccacctggtccgctggaacgagctgacggagaaggagcaggcccgc
ctgttcaccctgttccggcaccagatcttcccggtgctgacccccctcgccgtcgacccc
gcgcaccccttcccgtacatctcgggcctgtccctgaacctcgccgtggtcgtgcgcaac
ccggtcagcggccaccgccacttcgcccgcgtgaaggtcccgccgctgctctcccgcttc
ctggaggcgtcccccgaccgctacgtccccatcgaggacgtcatcgcggcgcacctggaa
gagctgttcccgggcatggaggtcctggagcaccacaccttccgcctcacccgcaacgag
gacctcgaggtcgaggaggacgacaccgagaacctgctccaggccctggagaaggagctc
atgcgccgccgcttcgggccgccggtgcgcctggaggtcgaggagtccatcgaccggcac
gtcctcgatctcctcgtacgggagctgaaggtctccgaggcggaggtctaccccctgccc
ggccccctggacctcaccggcctcttcggcatcggcgccctcgaccggcccgagctgaag
taccccaagttcatcgcgggcacccaccgcgacctcgccgaagtcgagtcggcgtccgcg
ccggacatcttcgccgccctgcgcgagcgcgacgtcctgctccaccacccgtacgacagc
ttctccacctccgtccaggccttcctggagcaggcggcgggcgaccccgacgtcctcgcc
atcaagcagaccctgtaccggacctcgggcgactcgccgatagtcgacgcgctgatcgag
gccgccgaggcgggcaagcaggtcctcgtactggtcgagatcaaggcccgcttcgacgag
caggccaacatcaagtgggcgcggaagctggaggagtccggctgccacgtcgtatacggc
ctcgtcggcctgaagacccactgcaagctgtcgctggtggtccggcaggagggcgagacc
ctgcggcgctactgccacgtcggcacgggcaactaccaccccaagaccgcccggctgtac
gaggacctgggcctgctcaccgccgacccgcaggtcggcgcggacctctccgacctcttc
aaccggctgtcgggctactcacgccgcgagacctaccgccgtctcctcgtcgcccccaag
tccctgcgcgacggcctggtctcacggatcaacaaggagatccagcaccaccaggccgga
cggcccgcgttcgtccgcatcaaggtcaactcgatggtggacgaggccatcatcgacgcc
ctctaccgcgcgtcccaggccggcgtcccggtcgacgtgtgggtgcgcggcatctgcgcg
gtgcgccccggcgtcacgggcatgtccgaaaacatacgggtgcgctccatcctcggccgc
ttcctcgaacactcgcgggtcttcacgttcggcaacggcggcgagcccgaggtgtggatc
ggcagcgccgacatgatgcaccgcaacctcgaccgccgcatcgaggccctcgtcagggtc
accgaccccgcccaccgggccgccctcaaccggctcctggaaaccgggatgtccgacacc
accgcctcctggcatctgggcccggacggcgagtggacacggcacgcgaccgatgccgag
ggccagcccctgcggaacgtccaggagatgctcatagacgcccggaggcgccggcgtggc
acagcgacaccttga

DBGET integrated database retrieval system