KEGG   Streptomyces avermitilis: SAVERM_1310
Entry
SAVERM_1310       CDS       T00126                                 
Symbol
rho2
Name
(GenBank) putative transcription termination factor
  KO
K03628  transcription termination factor Rho
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_1310 (rho2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sma03021]
    SAVERM_1310 (rho2)
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_1310 (rho2)
Transcription machinery [BR:sma03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription termination factor
     SAVERM_1310 (rho2)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SAVERM_1310 (rho2)
SSDB
Motif
Pfam: ATP-synt_ab Rho_RNA_bind AAA_25 Spore_III_AA DUF3086 NACHT AAA AAA_22
Other DBs
NCBI-ProteinID: BAC69020
NITE: SAV1310
UniProt: Q82NJ3
Position
1619721..1620860
AA seq 379 aa
MTTTLEHPPVQQQLPAHATGVLDIAQGGQGYLRTGNCLPTPNDLQVPAALIRRHGLRKGD
VVEGVRGGQRGLTEVASVNGRAPEQLRGRPHFRDLTPLHPRERIRLEHPAGGLSTRVIDL
IAPVGKGQRGLIVAPPKTGKTVLLQQIAAAVAGNHPECHLMVVLLDERPEEVTDMRRSVR
GEVYASTFDRAPKQHIALAELVVERAKRLVEQGQDVVILLDSLTRLCRAHNNTAAAGGRT
LSGGVDAAALQGPKRFFGAARLAEEGGSLTILATALVETGSRADDFFFEELKSTGNMELR
LDRAPAAKRIYPAVDITPSGTRREELLLPSAELAAVRGLRRALQTRDGQANLETLLERLR
ATPDNTAFLRQVQPTLPAA
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgaccaccacactcgaacaccctcccgtacagcagcagctcccggcccacgccaccggt
gtcctcgacatcgcacagggcgggcaggggtacctgcgcaccgggaactgcctgcccact
ccgaacgacctccaggtccccgccgcgctgatccgccgtcacggcctgcgcaagggcgac
gtcgtcgaaggcgtacgcggcggccagcgcggcctcaccgaggtggcgtcggtcaacggc
cgcgcccccgagcagctgcgcggccgcccccacttccgtgacctcaccccgctgcacccc
cgcgaacggatccggctcgaacaccccgcgggcgggctgtccacccgggtgatcgacctg
atcgccccggtcggcaagggccagcgcgggctcatcgtcgccccgcccaagaccggcaag
accgtgctgctccagcagatcgccgcggccgtcgccgggaaccaccccgagtgccacctg
atggtggtgctgctcgacgagcgccccgaggaagtcaccgacatgcggcggtccgtgcgc
ggcgaggtgtacgcctcgaccttcgaccgggcaccgaagcagcacatcgcgctcgccgaa
ctcgtcgtcgaacgggccaagcggctcgtcgaacagggccaggacgtcgtcatcctcctg
gactcgctcacccggctgtgccgggcgcacaacaacacggccgccgccggaggccgcacg
ctcagcggtggtgtcgacgctgccgcgctccagggccccaagcggttcttcggcgcggcg
cgcctggccgaggagggcggttcgctcaccatcctcgccacggccctggtggagaccggc
tcccgcgccgacgacttcttcttcgaggagctcaagagcacgggcaacatggaactccgc
ctcgaccgcgcaccggccgccaagcggatctacccggccgtcgacatcaccccgtccggc
acccgccgcgaggaactcctgctgccttcggccgagttggccgccgtacgaggactgcgc
cgcgccctgcagacccgggacggccaggccaacctcgaaaccctcctggagcgcctgcgc
gccacgccggacaacacggccttcctgcgccaggtccagccgacgctgcccgccgcatag

KEGG   Streptomyces avermitilis: SAVERM_2915
Entry
SAVERM_2915       CDS       T00126                                 
Symbol
rho1
Name
(GenBank) putative transcription termination factor Rho
  KO
K03628  transcription termination factor Rho
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_2915 (rho1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sma03021]
    SAVERM_2915 (rho1)
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_2915 (rho1)
Transcription machinery [BR:sma03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription termination factor
     SAVERM_2915 (rho1)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SAVERM_2915 (rho1)
SSDB
Motif
Pfam: Rho_RNA_bind ATP-synt_ab Rho_N AAA_25 NACHT AAA Spore_III_AA
Other DBs
NCBI-ProteinID: BAC70626
NITE: SAV2915
UniProt: Q82J67
Position
complement(3646335..3648401)
AA seq 688 aa
MSDTTDLMGARVEETAAAPATDASAPATGAGSRRRRGTGLEGMVLAELQQVASGLGIRGT
ARMRKSQLIEVIKEAQAGGGAPAKAAASAADATETKPKRRATSKARTGDDAAPAEKAERA
AKPAAEKAVAQQQIEIPGQPASEDAPAERRRRRATAEAGSPETVAAEAKSEPKAETPAGE
AKGDAADGGEGRQGRRDRRDRGDRGDRGERGDRGDRGERGDRGDRGRDRDRRGNKGDEQQ
GQGGQQRGGGQQQATGRQDRQDRQRDNGPQDDDDFEGGRRGRRGRYRDRRGRRGRDEFGA
NEPQVADDDVLIPVAGILDILDNYAFIRTSGYLPGPNDVYVSLAQVRKNGLRKGDHVTGA
VRQPKDGERREKFNALVRLDSVNGMAPESGRGRPEFNKLTPLYPQDRLRLETDPGVLTTR
IIDLVAPIGKGQRGLIVAPPKTGKTMIMQAIANAITTNNPECHLMVVLVDERPEEVTDMQ
RSVKGEVISSTFDRPAEDHTTVAELAIERAKRLVELGHDVVVLLDSITRLGRAYNLAAPA
SGRILSGGVDSTALYPPKRFFGAARNIEDGGSLTILATALVDTGSRMDEVIFEEFKGTGN
AELKLDRKLADKRIFPAVDVDASGTRKEEILLGSDELAITWKLRRVLHALDQQQAIELLL
DKMKQTKSNAEFLLQIQKTTPMPGNGND
NT seq 2067 nt   +upstreamnt  +downstreamnt
gtgagcgacaccaccgatctgatgggcgcacgtgtcgaggagaccgctgccgcgcccgcc
acggacgcctccgcgcctgccaccggtgccggctcccggcggcgccgcggtaccggcctc
gagggcatggtgctggccgagctgcagcaggtcgcatccggcctcggcatcaggggcacc
gcgcggatgcgcaagagccagctgatcgaggtcatcaaggaggcgcaggcgggcggcggc
gccccggccaaggcggcagcgtccgccgcggacgccaccgagaccaagcccaagcgccgt
gccacctccaaggctcgtacgggcgacgacgccgcccccgccgagaaggcggagcgggcc
gcgaagcccgccgccgagaaggccgtggcgcagcagcagatcgagatccccggccagccc
gccagcgaggacgccccggccgagcgccgccggcgccgtgccaccgccgaggccggcagc
cccgagacggtcgccgccgaggcgaagagcgagccgaaggccgagacgcccgccggcgag
gccaagggcgacgccgccgacggcggcgagggccgtcagggccgccgcgaccgccgtgac
cgtggcgaccgcggagaccgtggagagcggggcgaccgtggagaccgtggagagcggggc
gaccgcggggaccgcggccgggaccgcgaccgccgtggcaacaagggcgacgagcagcag
ggccagggcggccagcagcgcggcggcggccagcagcaggccaccggccgccaggaccgc
caggaccgtcagcgtgacaacggcccgcaggacgacgacgacttcgagggtggccgccgc
ggtcgccgcggtcgttaccgggaccgccgtggccgccgtggccgcgacgagttcggcgcc
aacgagccgcaggtcgccgacgacgacgtcctgatccccgtcgcgggcatcctggacatc
ctcgacaactacgcgttcatccggacgtccggctacctgccgggtccgaacgacgtgtac
gtctccctcgcccaggtccgcaagaacggcctgcgcaagggcgaccacgtcaccggcgcg
gtccgtcagcccaaggacggcgagcggcgcgagaagttcaacgcgctcgtccgcctcgac
tcggtcaacggcatggcgcccgaatccgggcgcgggcgaccggagttcaacaagctgacg
cccctttacccgcaggaccggctccgcctggagaccgacccgggcgtgctgacgacccgc
atcatcgacctcgtcgcgccgatcggtaagggccagcgcggtctgatcgtggccccgccg
aagaccggcaagaccatgatcatgcaggcgatcgccaacgcgatcacgaccaacaacccc
gagtgccacctgatggtcgtcctggtcgacgagcgtccggaagaggtcaccgacatgcag
cggtcggtgaagggcgaggtcatctcctcgaccttcgaccgcccggccgaggaccacacc
acggtcgccgagctcgccatcgagcgcgccaagcggctggtggagctgggccacgacgtg
gtcgtcctgctcgactcgatcacgcgtctgggccgtgcgtacaacctcgccgcgcccgcc
tccggccgcatcctgtccggtggtgtcgactcgaccgcgctgtacccgccgaagcgcttc
ttcggtgccgcgcgcaacatcgaggacggcggctcgctgaccatcctggccaccgcgctc
gtcgacaccggctcgcgcatggacgaggtgatcttcgaggagttcaagggcaccggcaac
gcggagctcaagctcgaccggaagctcgccgacaagcgcatcttcccggcggtggacgtc
gatgcgtccggcacccgtaaggaagagatcctgctcggcagcgacgagctcgccatcacc
tggaagctgcgtcgcgtgctgcacgcgctcgaccagcagcaggcgatcgagctgctgctc
gacaagatgaagcagacgaagtcgaacgccgagttcctgctccagattcagaagacgacg
ccgatgccgggcaacggcaacgactga

DBGET integrated database retrieval system