KEGG   Streptomyces avermitilis: SAVERM_1336
Entry
SAVERM_1336       CDS       T00126                                 
Symbol
sseC
Name
(GenBank) putative thiosulfate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00270  Cysteine and methionine metabolism
sma00920  Sulfur metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SAVERM_1336 (sseC)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_1336 (sseC)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAVERM_1336 (sseC)
Enzymes [BR:sma01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     SAVERM_1336 (sseC)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     SAVERM_1336 (sseC)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-ProteinID: BAC69046
NITE: SAV1336
UniProt: Q82NG7
Position
complement(1647024..1648022)
AA seq 332 aa
MWDTLAQWARYRSSGAASIRRRVSIPAMTDALLSGPLVDDAWLAAHLDDPRLVVLDATAL
LPSPRHDGDHRSGSGHAQWAERHIPGSRHADLTGDLSDHEAPYHFAVPSPRALADALQRL
GVRDGSEVVAYDSGGGIWAARLWWMLRSISVPAAVLDGGWAVWEEGGHPVAHGDETGAVR
VSRPLTPVPRPDVWTGIDEVAAISRGERPGTLVCALPPGGFDGSAATRYSRRGHIPGSLS
LPGRGLLDATGRLLPRSELARRTGAVLQDAESPVVLYCGGGISAAGTALALTLLGREDIS
LYDGSLEEWSGDLSRPIRLGHQLGDQRLGDQR
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtgggacacccttgcccagtgggcgagatatcgcagttcaggggcggcctctatccgc
cgccgggttagcatcccggccatgaccgacgccctgctttccggaccgctcgtcgacgac
gcctggctcgcggcccacctcgacgacccccgactggtcgtcctcgacgccaccgcgctg
ctgccgtcgccccgccacgacggcgaccaccggtccggcagcggccacgcccagtgggcc
gagcgccacatcccgggctcccgccacgccgacctcacgggtgacctgtccgaccacgag
gcgccgtaccacttcgcggtcccgtctccgagggcgctggccgacgctctccagcggctc
ggtgtgcgcgacggctccgaggtcgtcgcgtacgacagcggcggcggcatctgggcggcc
cggctgtggtggatgctgcggtcgatctccgtaccggcggcggtacttgacggagggtgg
gccgtctgggaggagggcgggcacccggtcgcccacggcgacgagacgggtgccgtgcgg
gtctcgcggccgctcacgccggtacctcgtcccgatgtgtggaccggtatcgacgaggtg
gccgccatcagtcgaggtgagcgtcccggcacactggtgtgcgccctgccgcccggcggc
ttcgacggctctgccgccacgcgctacagccgccggggccacattcccggcagcctcagc
ctcccgggacgcggtctgctcgatgccaccgggcgactcctgccccgctccgaactcgcc
cggcgcaccggcgcagttctccaggacgccgagtcgcccgtcgtcctctactgcggtggt
ggcatctcggccgccggcaccgcactcgccctgacgctgctcggccgtgaggacatcagc
ctgtacgacggttcgctggaagagtggtccggggacctgtccaggccgatcaggctgggt
catcagctgggtgatcagcggctgggtgatcagcggtga

KEGG   Streptomyces avermitilis: SAVERM_2412
Entry
SAVERM_2412       CDS       T00126                                 
Symbol
sseB
Name
(GenBank) putative thiosulfate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00270  Cysteine and methionine metabolism
sma00920  Sulfur metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SAVERM_2412 (sseB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_2412 (sseB)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAVERM_2412 (sseB)
Enzymes [BR:sma01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     SAVERM_2412 (sseB)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     SAVERM_2412 (sseB)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-ProteinID: BAC70123
NITE: SAV2412
UniProt: Q82KJ1
Position
complement(2939732..2940583)
AA seq 283 aa
MNVIISASELASELAGPNPPTLLDVRWQLSTAKAGGAAPFDGRAAYASGHVPGAVFVDLD
ADLAGPAGPAGRHPLPDLAHFGEAMRAAGVSARRPVVVYDGGQGWAAARAWWMLRWTGHP
AVRVLDGGLAAWSGPVTTETEELVAGDFEPAPGALPLLDADGAAALARTGLLLDARAAER
YRGDVEPIDPVGGHIPGAVSAPTTENVAENGRFRPAAELADRFKSLGVNDAAEVGVYCGS
GVSAAHEVLALAVAGIPAALYVGSWSEWSAAGSRPVAAGPDPQ
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaacgtcatcatctccgcatccgaactggcgagcgagctggcggggccgaacccgccg
accctcctggacgtccgctggcagctgagcacagccaaggcgggtggtgccgccccgttc
gacggccgggccgcgtatgcgtccgggcacgttcccggcgccgtcttcgtggatctggac
gccgatctggccggccccgcgggccctgccggacggcatccgctgccggatctcgcgcac
ttcggcgaggccatgcgggccgccggtgtctcggcgcggcggccggtggtcgtgtacgac
ggtgggcagggctgggccgccgcgcgcgcgtggtggatgttgcgctggacgggtcacccg
gcggtgcgagtgcttgacggcggcctcgcggcgtggagcggaccggtgaccacggagacc
gaggagttggtcgccggggacttcgagcccgcgcccggcgccctgccgcttctcgacgcc
gacggcgccgcggcgctcgcccgtaccggtctgctgctcgacgcgcgggccgccgagcgc
taccgcggtgacgtggagccgatcgacccggtcggcggccacatcccgggcgcggtgtcg
gccccgaccacggagaacgtggccgagaacggccggttccggcccgctgccgaactggcc
gaccgcttcaagtcgctcggcgtgaacgacgcggccgaggtcggcgtgtactgcggctcg
ggggtctccgccgcgcacgaggtgctcgcgctggcggtcgccggaatcccggccgcgctc
tacgtggggtcctggtcggagtggtcggcggccggcagccgtcccgtcgccgcgggtccc
gacccccagtga

KEGG   Streptomyces avermitilis: SAVERM_4037
Entry
SAVERM_4037       CDS       T00126                                 
Symbol
sseA
Name
(GenBank) putative thiosulfate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00270  Cysteine and methionine metabolism
sma00920  Sulfur metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SAVERM_4037 (sseA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_4037 (sseA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAVERM_4037 (sseA)
Enzymes [BR:sma01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     SAVERM_4037 (sseA)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     SAVERM_4037 (sseA)
SSDB
Motif
Pfam: Rhodanese AcylCoA_DH_N
Other DBs
NCBI-ProteinID: BAC71749
NITE: SAV4037
UniProt: Q82G61
Position
complement(4955552..4956391)
AA seq 279 aa
MSRSDVLVDADWVQDHLDDPSVAIVEVDEDTSAYEKNHIRNAIRIDWTKDLQDPVRRDFI
DQEGFEKLLSEKGIANDTLVVLYGGNNNWFASYAYWYFKLYGHENVKLLDGGRKKWELDS
RDLVAEVPTRATTDYKAKAQNTAIRAFRDDVVAAIGSQNLVDVRSPDEFSGKLLAPAHLP
QEQSQRPGHIPSARNIPWSKNANDDGTFKSDDELKELYVEEQVDLAKDTIAYCRIGERSA
LTWFVLHELLGVENVKNYDGSWTEYGSLVGVPIELGANK
NT seq 840 nt   +upstreamnt  +downstreamnt
atgagccgcagcgacgtcctggtcgacgccgactgggtccaggaccacctggacgacccg
agcgtggccatcgtcgaggtcgacgaggacacgtccgcgtacgagaagaaccacatcagg
aacgcgatccggatcgactggaccaaggacctccaggacccggtccgccgtgacttcatc
gaccaggagggcttcgagaagctcctgtcggagaagggcatcgccaacgacacgctggtg
gtcctctacggcggcaacaacaactggttcgcgtcctacgcctactggtacttcaagctc
tacggccacgagaacgtcaagcttctcgacggcggccgcaagaagtgggagctcgactcc
cgcgacctggtcgccgaggtgcccacccgcgccacgaccgactacaaggccaaggcccag
aacaccgcgatccgcgccttccgcgacgacgtcgtggcggccatcggttcgcagaacctg
gtcgacgtccgctcgcccgacgagttcagcggcaagctgctcgccccggcccacctgccg
caggagcagtcgcagcgtccgggccacatcccgagcgcccgcaacatcccgtggtcgaag
aacgccaacgacgacggcaccttcaagtcggacgacgagctcaaggagctctacgtcgag
gagcaggtcgacctcgccaaggacacgatcgcgtactgccgcatcggtgagcgttccgcg
ctcacctggttcgtgctgcacgagctgctcggcgtggagaacgtcaagaactacgacggc
tcctggaccgagtacggcagcctggtcggcgtcccgatcgagctcggcgccaacaagtaa

DBGET integrated database retrieval system