KEGG   Streptomyces avermitilis: SAVERM_1375
Entry
SAVERM_1375       CDS       T00126                                 
Symbol
hisC3
Name
(GenBank) putative histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00340  Histidine metabolism
sma00350  Tyrosine metabolism
sma00360  Phenylalanine metabolism
sma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sma00401  Novobiocin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SAVERM_1375 (hisC3)
   00350 Tyrosine metabolism
    SAVERM_1375 (hisC3)
   00360 Phenylalanine metabolism
    SAVERM_1375 (hisC3)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAVERM_1375 (hisC3)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SAVERM_1375 (hisC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_1375 (hisC3)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SAVERM_1375 (hisC3)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class II
   SAVERM_1375 (hisC3)
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 pPIWI_RE_Y
Other DBs
NCBI-ProteinID: BAC69085
NITE: SAV1375
UniProt: Q82NC8
Position
1693060..1694154
AA seq 364 aa
MDVPVLHRLALNESPYPPLPSVRKAMRRAVAQAHRYPQFYPDDLTELIAAWCRVTPDRVV
VGSGSVGVALQLLQAVVEHGDTMAYAWRTFDAYPLLAAMVGAHPVPVPLSPDGQQDLGAL
LAALDHRTRVVVLCNPHNPTGSLVTADDLSAFLRQVPPRVTVLLDEAYVEFARGPGLPDT
PALLGAHPNLLVLRTFSKAYGLVALRVGYGLGAPDLVARIRRQQLPFGINAVATAAVRAS
LRADGELRLRVDTVVAERERLRHELVDLGWRVRPGHANSAWLDAPDPIDEGAAALTAAGV
QARHYPGEGLRLTVGSRKANDAVLAALAGVGRHTASGRRASSAAPDGTVAAHRRPPVSGQ
RPDG
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggacgtcccggtgctgcaccgactggccctgaacgaaagcccgtaccccccgctgccc
tcggtccgcaaggcgatgcgacgggccgtcgcacaggcccaccggtacccgcagttctac
cccgacgacctcaccgaactgatcgccgcgtggtgccgggtgacccccgaccgcgtcgtg
gtcggcagcggatcggtgggcgtcgcactccagttgctccaggcggtcgtcgagcacggc
gacacgatggcctacgcctggcgtaccttcgacgcgtatcccctgctggccgccatggtc
ggcgctcatcccgttcccgtacccctgtcgccggacggacaacaggatctgggcgccctg
ctcgcggcgctcgaccaccgcacccgtgtcgtggtgctgtgcaatccgcacaaccccacc
ggaagcctggtcaccgcggacgatctgtcggcgttcctgcgtcaggtccccccacgcgtc
accgtgctcctcgacgaggcgtacgtggagttcgcccgcggtcccggcctgccggacaca
cccgcgctcctgggcgcgcaccccaacctgctggtcctgcgcaccttctccaaggcctac
ggcctcgtcgccctgcgggtcggttacggactcggcgcccccgacctggtggcgcggatc
cgccggcaacagctgcccttcgggatcaacgcggtggcgacggcggcggtgcgggcctcg
ctgcgggccgacggcgagctgcgcctacgtgtggacaccgtcgtcgccgaacgcgaacgg
ctccggcacgaactcgtcgacctcggctggcgcgttcgcccgggccacgccaactctgcc
tggctcgacgcgccggatccgatcgacgagggcgccgcggcactcaccgccgccggtgtc
caggcgcgccactaccccggcgagggactccggctcaccgtcggcagccgcaaggcgaac
gacgccgtgctcgccgcgctggcgggagtcggccgacacacggcgtccggcaggcgcgcc
tcgtccgcagcacccgacgggacggtcgccgcccatcggcgaccgccggtgagcgggcag
cggccggacggatga

KEGG   Streptomyces avermitilis: SAVERM_4261
Entry
SAVERM_4261       CDS       T00126                                 
Symbol
hisC2
Name
(GenBank) putative histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00340  Histidine metabolism
sma00350  Tyrosine metabolism
sma00360  Phenylalanine metabolism
sma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sma00401  Novobiocin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SAVERM_4261 (hisC2)
   00350 Tyrosine metabolism
    SAVERM_4261 (hisC2)
   00360 Phenylalanine metabolism
    SAVERM_4261 (hisC2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAVERM_4261 (hisC2)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SAVERM_4261 (hisC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_4261 (hisC2)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SAVERM_4261 (hisC2)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class II
   SAVERM_4261 (hisC2)
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Alliinase_C
Other DBs
NCBI-ProteinID: BAC71973
NITE: SAV4261
UniProt: Q82FJ1
Position
complement(5226731..5227810)
AA seq 359 aa
MSETSPKLRAELEGIPTYKPGKPAAAAGPVAYKLSSNENPYPPLPGVLESVASSVGSFNR
YPDMACSGLMSELSERFGVPLSHLATGTGSVGVAQQLLQATSGPGDEVIYAWRSFEAYPI
ITQVSGATSVQVPLTPGDVHDLDAMADAITDRTRLIFVCNPNNPTGTVVRRAELERFLDR
VPSDVLVVLDEAYREFIRDPEVPDGVAIYRERPNVCVLRTFSKAYGLAGLRVGFAIAHEP
VAAALRKTAVPFGVSQLAQDAAVASLRAEDELLGRVGALVCERQRVVASLREQGWTVPET
QANFVWLRLGERTLDFAAACEQAGVVVRPFAGEGVRVTVGENEANDIFLKVTERFRKEL
NT seq 1080 nt   +upstreamnt  +downstreamnt
gtgagcgagacgagcccgaagctgcgtgccgagctggagggtatccccacctacaagccc
ggcaagccggccgcggccgccggaccggtggcgtacaagctgtcctccaacgagaatccc
tatccgccgctgccgggtgtgttggagagcgtggcctcgtcggtcgggtccttcaaccgt
tacccggacatggcgtgctcggggctgatgagcgagctgtcggagcgcttcggagtgccc
ctgtcgcacctggccaccggtaccggctcggtcggggtcgcccagcagctcctccaggcc
acgagcggtccgggcgacgaggtgatctacgcctggcggtccttcgaggcctacccgatc
atcacgcaggtcagcggcgcgacctccgtacaggtgccgctgacgccgggcgatgtgcac
gacctggacgcgatggcggacgcgatcaccgaccgtacgcggctgatcttcgtctgtaac
cccaacaaccccacgggcacggtggtgcgccgggccgagctggagcggttcctcgaccgg
gtgcccagcgatgtgctggtggtgctggacgaggcgtaccgcgagttcatccgtgacccc
gaggtgccggacggcgtggccatctaccgggagcggccgaacgtctgtgtgctgcggacg
ttctcgaaggcgtacggcctcgcggggctgcgcgtggggttcgcgatcgcccacgagccg
gtggcggcggcgctgcgcaagacggcggtcccgttcggagtgagccagctggcgcaggac
gccgcggtggcctcgctgcgcgccgaggacgaactgctcggccgggtcggcgcattggtg
tgcgagcgccagcgcgtggtcgcctcgctgcgcgagcagggctggacggtgcccgagaca
caggcgaacttcgtgtggctgcggctgggggagcgcacgctcgacttcgcggccgcctgt
gagcaggccggtgtcgtcgtacggccgttcgccggcgaaggggtgcgtgtgacggtcggc
gagaacgaggcgaacgacatcttcctgaaggtgacggaacggttccgcaaggagctctag

KEGG   Streptomyces avermitilis: SAVERM_6154
Entry
SAVERM_6154       CDS       T00126                                 
Symbol
hisC1
Name
(GenBank) putative histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00340  Histidine metabolism
sma00350  Tyrosine metabolism
sma00360  Phenylalanine metabolism
sma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sma00401  Novobiocin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SAVERM_6154 (hisC1)
   00350 Tyrosine metabolism
    SAVERM_6154 (hisC1)
   00360 Phenylalanine metabolism
    SAVERM_6154 (hisC1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAVERM_6154 (hisC1)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SAVERM_6154 (hisC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_6154 (hisC1)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SAVERM_6154 (hisC1)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class II
   SAVERM_6154 (hisC1)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-ProteinID: BAC73865
NITE: SAV6154
UniProt: Q82AA5
Position
7402037..7403146
AA seq 369 aa
MSFGIDDLPVRDELRGKSPYGAPQLDVPVRLNTNENPYPLPEPLVERIAERVREAARHLN
RYPDRDAVELRTELATYLTNTGKHPVGIENVWAANGSNEVIQQLLQTFGGPGRTAIGFEP
SYSMHALIARGTGTAWISGPRGEDFTIDLAAARQAIAESRPDVVFITTPNNPTGTAVPPE
TVLALYEAAQAVKPSMVVVDEAYIEFSHGDSLLPLLEGRPHLVVSRTMSKAFGAAGLRLG
YLAAHPAVVDAVQLVRLPYHLSAITQATALAALEHTDTLLGYVEQLKAERDRLVAELRAI
GYDVTESDANFVQFGRFADAHEVWQQILDRGVLVRDNGVPGWLRVSAGTPEENDAFLDAV
RELKKEQNA
NT seq 1110 nt   +upstreamnt  +downstreamnt
gtgagcttcggaatcgacgatctccccgtacgggacgagctgcgcggcaagtccccctac
ggcgcgccccagctcgacgtccccgtacggctgaacaccaacgagaatccgtacccgctg
cccgagccgctcgtcgagcggatcgccgagcgggtgcgggaggccgcccgtcacctcaac
cgctaccccgaccgggacgcggtggagctgcgcacggagctggccacgtacctgacgaac
accggcaagcaccccgtcggcatcgagaacgtctgggcggccaacggctccaacgaggtc
atccagcagctgctccagaccttcggcggacccggccgcacggcgatcggcttcgagccg
tcgtactcgatgcacgccctcatcgcgcgcggcacgggcaccgcctggatctccggtccc
cggggcgaggacttcacgatcgacctcgccgccgcccggcaggccatcgccgagagccgg
ccggacgtcgtcttcatcacgacccccaacaaccccacgggcaccgcggtcccgcccgag
acggtcctcgcgctgtacgaggccgcgcaggcggtgaagccgtcgatggtggtggtcgac
gaggcgtacatcgagttcagccacggcgactccctgctgccgctgctcgaaggccggccg
catctcgtcgtctcgcgcaccatgtccaaggcgttcggcgcggccgggctgcgcctcggc
tatctcgccgcgcacccggcggtggtcgacgccgtccagctcgtacggctgccgtaccac
ctgtcggccatcacgcaggcgaccgcgctggccgccctggagcacaccgacaccctgctc
ggttacgtggagcagttgaaggccgagcgggaccggctggtcgccgagctgcgcgcgatc
ggctacgacgtgaccgagtccgacgcgaacttcgtgcagttcgggcggttcgccgacgcg
cacgaggtctggcagcagatcctcgaccggggcgtcctggtccgggacaacggcgtaccg
ggatggctgcgggtcagcgccggtacccccgaagagaacgacgcgttcctcgacgcggtc
cgtgagctgaagaaggagcagaacgcatga

KEGG   Streptomyces avermitilis: SAVERM_6404
Entry
SAVERM_6404       CDS       T00126                                 
Symbol
cobC
Name
(GenBank) putative aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00340  Histidine metabolism
sma00350  Tyrosine metabolism
sma00360  Phenylalanine metabolism
sma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sma00401  Novobiocin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SAVERM_6404 (cobC)
   00350 Tyrosine metabolism
    SAVERM_6404 (cobC)
   00360 Phenylalanine metabolism
    SAVERM_6404 (cobC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAVERM_6404 (cobC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SAVERM_6404 (cobC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_6404 (cobC)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SAVERM_6404 (cobC)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class II
   SAVERM_6404 (cobC)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-ProteinID: BAC74115
NITE: SAV6404
UniProt: Q829K7
Position
complement(7678794..7679774)
AA seq 326 aa
MNVRADTPPAWLRERIAESLGGLAAYPDGRAARAAVAQRHALPVERVLLTAGAAEAFVLL
ARALKVRRPVVVHPQFTEPEAALRDAGHTVDRVLLREEDGFRLDAGAVPEDADLVVIGNP
TNPTSVLHPAASIAELARPGRTLVVDEAFMDAVPGEREALSGRTDVPGLVVLRSLTKTWG
LAGLRIGYVLAAPETVAELERAQPLWPVSTPALAAAEVCVSPRALAEAAHAAHRIAADRA
HLVAGLREFASDGLCVAEPAEGPFVLVRLPRAAAVRGHLRGLGFAVRRGDTFPGLGEEWL
RLAVRDRATVNRFLQALDRAVTLADR
NT seq 981 nt   +upstreamnt  +downstreamnt
gtgaacgtgcgggccgacacgcccccggcctggctgcgcgagcggatcgccgagtcgctg
ggcgggctcgcggcatacccggacgggcgtgcggcgcgggccgcggtggcacagcggcac
gcgctgcccgtggagcgggtgctgctcacggcgggcgccgccgaggcgttcgtgctgctc
gcgcgggctctgaaggtgcgccggccggtggtcgtgcacccgcagttcacggagccggag
gcggctctgcgggacgcggggcacacggtggaccgggtgctgctgcgggaggaggacggc
ttccggctggacgcgggggccgtgcccgaggacgcggatctggtcgtgatcggcaatccg
accaacccgacgtcggtactgcacccggccgcgtcgatcgccgaactggcccggcccggg
cggacgttggtggtggacgaggcgttcatggacgcggtgccgggtgagcgggaggcgctc
tccgggcggacggacgtccccggtctggtggtgctgcgcagtctcaccaagacatggggg
ctggcggggctgcgcatcggctacgtgctcgccgcgcccgagacggtcgccgagctggag
cgggcgcagccgctgtggccggtgtccacgcccgcgctggcggcggcggaggtgtgcgtg
tcgccgcgggcactggcggaggccgcgcacgcggcgcaccgtatcgcggcggaccgggcg
catctggtcgcggggctgcgggagttcgcctccgacgggctgtgcgtggcggagccggcc
gagggtcctttcgtcctggtgcggcttccgcgggcggccgcggtgcggggtcacttgcgc
gggctgggcttcgccgtgcgtcggggggacacgtttccggggctgggcgaggagtggctg
cggctggcggtgcgggaccgggcgacggtgaaccggtttctccaggcgttggaccgggcg
gtcacgttggcggaccgctga

DBGET integrated database retrieval system