KEGG   Streptomyces avermitilis: SAVERM_1445
Entry
SAVERM_1445       CDS       T00126                                 
Symbol
gatY
Name
(GenBank) putative tagatose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00030  Pentose phosphate pathway
sma00051  Fructose and mannose metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_1445 (gatY)
   00030 Pentose phosphate pathway
    SAVERM_1445 (gatY)
   00051 Fructose and mannose metabolism
    SAVERM_1445 (gatY)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_1445 (gatY)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SAVERM_1445 (gatY)
SSDB
Motif
Pfam: F_bP_aldolase TGF_beta_GS
Other DBs
NCBI-ProteinID: BAC69155
NITE: SAV1445
UniProt: Q82N58
Position
complement(1779895..1780800)
AA seq 301 aa
MPLAATGDLIAGATADHTAVAAFNIITLEHVEAVIAGAESVGAPVVLQISENAVKFRYGR
LLPLARAAAAAAERASVAVALHLDHVQSDDLLRQAPGAGFGSVMYDAARLPYAENLAATR
AAADWAHARGLWIEAELGQVGGKNGEPPLDAHAAGARTDPAEARAFVADSGVDALAVAIG
SSHAMTSRTAALDHGLLRRLAAQLDVPLVLHGSSGLPDDELAAAVTGGIAKVNIGTALNL
AMTRAIREFLAAHPDAVDSRKYLSVGREAMAAAAAELIAVLRAAGGPQHRTTGSGSGTPT
S
NT seq 906 nt   +upstreamnt  +downstreamnt
gtgccactggcagcaaccggtgacctcatcgccggagccaccgcggaccacaccgccgtc
gccgcgttcaacatcatcaccctggagcacgtcgaggccgtcatcgcgggcgcggagtcc
gtcggcgcgccggtcgtcctccagatcagcgagaacgccgtcaagttccgctacggccgt
ctgctcccgctggcccgggccgcggccgcggccgccgaacgggcgtcggtggcggtcgca
ctccatctcgaccacgtccagagcgacgacctgctgcgccaggcgcccggcgccggattc
ggctccgtgatgtacgacgcggcccggctgccgtacgccgagaacctcgcggcgacccgc
gccgccgccgactgggcacatgcccgagggctctggatcgaggccgagttgggacaggtc
ggcggcaagaacggcgagccgccgctggacgcgcacgcggccggagcccgcaccgatccg
gccgaggcgcgcgccttcgtggccgactccggagtggacgcactggccgtggcgatcggc
agctcgcacgcgatgacctcgcgcacggccgcgctcgaccacggtctgctcaggcggctc
gccgcgcagctggacgtaccgctcgtcctgcacggctcctccggcctgccggacgacgaa
ctggcggcggccgtcacgggcggcatagccaaggtcaacatcgggaccgcgctgaacctc
gcgatgaccagagcgatcagggagttcctcgccgcacatcccgacgcggtcgactcacgc
aagtacctcagtgtggggcgggaggcgatggcggccgcggcggcggagctcatcgcggtg
ctgcgggccgccggcggcccgcagcaccggacgaccggctcgggtagcgggacgcctact
tcttga

KEGG   Streptomyces avermitilis: SAVERM_4523
Entry
SAVERM_4523       CDS       T00126                                 
Symbol
fbaA
Name
(GenBank) putative fructose 1,6-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00030  Pentose phosphate pathway
sma00051  Fructose and mannose metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4523 (fbaA)
   00030 Pentose phosphate pathway
    SAVERM_4523 (fbaA)
   00051 Fructose and mannose metabolism
    SAVERM_4523 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_4523 (fbaA)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SAVERM_4523 (fbaA)
SSDB
Motif
Pfam: F_bP_aldolase
Other DBs
NCBI-ProteinID: BAC72235
NITE: SAV4523
UniProt: Q82EU0
Position
5525590..5526612
AA seq 340 aa
MPIATPEVYNEMLDRAKAGKFAYPAINVTSTQTLHAALRGFAEAESDGIVQISTGGAEFL
GGQYKKDMVTGAVALAEFAHIVAEKYPVTVALHTDHCPKDKLDGYVRPLLAISEERVKAG
RNPLFQSHMWDGSAETLADNLAIAQELLEKARAAKIILEVEITPTGGEEDGVTHEINDSL
YTTVEDAIRTAEALGLGEKGRYLLAASFGNVHGVYKPGNVVLRPELLKELNEGVAAKFGK
ADPFDFVFHGGSGSTEAEIRTALENGVVKMNIDTDTQYAFTRPVADHMFRNYDGVLKVDG
EVGDKKTYDPRTWGKLAEASMAKRVTEACANLRSTGTKIK
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccatcgcaacccccgaggtctacaacgagatgctcgaccgggcgaaggcaggcaag
ttcgcctacccggccatcaacgtgacctcgacccagaccctgcacgctgcgctgcgcggc
ttcgcggaggccgagagcgacggcatcgtccagatctccaccggtggtgcggagttcctg
ggtggtcagtacaagaaggacatggtcaccggcgccgtggcgctggccgagttcgcgcac
atcgtcgccgagaagtacccggtcacggtcgccctgcacacggaccactgcccgaaggac
aagctcgacgggtacgtccgtccgctgctcgcgatctccgaggagcgcgtcaaggccggc
cggaacccgctgttccagtcgcacatgtgggacggctcggcggagaccctcgccgacaac
ctggccatcgcgcaggagctgctcgagaaggcccgcgccgcgaagatcatcctcgaggtg
gagatcaccccgaccggcggcgaggaagacggcgtcacccacgagatcaacgactcgctg
tacacgacggtcgaggacgcgatccgcacggcggaggcgctgggcctgggcgagaagggc
cgctacctgctggccgcgtccttcggcaacgtgcacggtgtgtacaagccgggcaacgtc
gtgctccgcccggagctcctgaaggagctcaacgagggcgtggccgcgaagttcggcaag
gccgacccgttcgacttcgtcttccacggcggctccggctccacggaggccgagatccgc
acggccctggagaacggcgtcgtcaagatgaacatcgacaccgacacccagtacgcgttc
acgcgtccggtcgccgaccacatgttccgcaactacgacggcgtcctgaaggtcgacggc
gaggtcggcgacaagaagacctacgacccgcgtacgtggggcaagctggccgaggcgtcg
atggccaagcgcgtcacggaggcctgcgcgaacctgcgctcgacgggcacgaagatcaag
taa

DBGET integrated database retrieval system