KEGG   Streptomyces avermitilis: SAVERM_1595
Entry
SAVERM_1595       CDS       T00126                                 

Name
(GenBank) putative 3-ketosteroid-delta-1-dehydrogenase
  KO
K05898  3-oxosteroid 1-dehydrogenase [EC:1.3.99.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00984  Steroid degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SAVERM_1595
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.4  3-oxosteroid 1-dehydrogenase
     SAVERM_1595
SSDB
Motif
Pfam: FAD_binding_2 FAD_oxidored NAD_binding_8
Other DBs
NCBI-ProteinID: BAC69306
NITE: SAV1595
UniProt: Q82MR5
Position
complement(1960490..1962097)
AA seq 535 aa
MTAALTAAKQGLSCVVVEKAATFGGSAARSGAGIWIPNNPVILAAGVPDTPAKAAAYLAA
VVGPDVSADRQRAFLGHGPAMISFVMANSPLRFRWMEGYSDYYPELSGGLPNGRSIEPDQ
LDGNILGAELAHLNPSYMAVPAGMVVFSADYKWLTLSAVSAKGLAVAAECLARGTKAALL
GQKPLTMGQSLAAGLRAGLLAAQVPVWLNTPLTDLYRENGTVTGAVVAKGGSAGLVRARH
GVVVGSGGFEHNAAMRDQYQRQPIGTAWTVGAKENTGDGIRAGERAGAALDLMDDAWWGP
TIPLPDQPYFCLAERTLPGGLLVNAAGARFVNEAAPYSDVVHTMYERNPTAPDIPAWLIV
DQNYRNRYLFKDVAPTLAFPGSWYDSGAAHKAWTLDALAGRIGMPAAALRATVNRFNSLA
LSGDDTDFQRGDSTYDHYYTDPAIVPNSCLAPLWLAPYYAFKIVPGDLGTKGGLRTDARA
RVLRADGSVIPGLYAAGNASAAVMGHSYAGAGSTIGPAMTFGYIAALDIAAAAGS
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaccgccgcgctgacggccgcgaagcaggggctgagctgcgtcgtcgtggagaaggcg
gccaccttcgggggctcggcggcgcggtccggcgcgggcatctggattccgaacaacccc
gtcatcctcgccgcgggcgtccccgacaccccggcgaaggccgccgcctacctcgcggcg
gtcgtcgggcccgacgtctccgccgaccggcagcgcgccttcctcggccacggacccgcc
atgatctccttcgtcatggcgaacagcccgctccgcttccgctggatggaggggtacagc
gactactaccccgagctctccggcgggctgccgaacggccgctccatcgaacccgaccag
ctcgacgggaacatcctcggcgccgaactcgcccacctgaacccgtcgtacatggccgtc
ccggccggcatggtcgtcttcagcgccgactacaagtggctcaccctgtccgcggtcagc
gccaagggcctcgccgtcgccgcggaatgcctggcccgcgggaccaaggcggccctcctc
ggccagaagcccctcaccatggggcagtcgctggccgcgggtctgcgcgccggcctgctc
gccgcccaggtgccggtgtggctgaacaccccgctgaccgatctgtaccgggagaacggg
acggtcaccggggcagtggtggccaagggcggctcggccggtctggtcagggcccggcac
ggggtcgtcgtcggctccggcgggttcgagcacaacgcggccatgcgcgaccagtaccag
cgccaacccatcggcaccgcgtggaccgtgggcgccaaggagaacaccggcgacggcatc
cgggccggcgagcgggctggcgccgcgctcgacctgatggacgacgcctggtggggaccg
acgatcccgctgcccgaccagccctacttctgtcttgccgaacgcaccctgcccggcggc
ctcctcgtcaacgccgccggagcgcggttcgtcaacgaagccgccccctacagcgacgtc
gtccacaccatgtacgagcggaacccgaccgccccggacatcccggcctggctgatcgtc
gaccagaactaccgcaaccgctacctcttcaaggacgtcgcgccgacgctcgcgttcccc
ggctcctggtacgactccggcgccgcgcacaaggcctggaccctggacgccctcgccggg
cggatcggcatgcccgcggccgccctgcgggccaccgtcaaccggttcaacagcctggcc
ctgagcggcgacgacaccgacttccagcgcggcgacagcacgtacgaccactactacacc
gaccccgcgatcgtgccgaactcctgtctggcccccctgtggctggccccgtactacgct
ttcaagatcgtcccgggggatctcggcaccaagggaggcctgcgcacggacgcacgcgcg
cgtgtgctgcgcgcggacggctcggtgatccccggcctgtacgcggcggggaacgccagt
gccgcggtgatggggcacagctatgcgggcgcgggctcgacgatcgggccggcgatgacc
ttcgggtacatcgccgccctggacatcgcggctgcggccggaagctga

DBGET integrated database retrieval system