KEGG   Streptomyces avermitilis: SAVERM_1752
Entry
SAVERM_1752       CDS       T00126                                 
Name
(GenBank) putative glycosyl hydrolase
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_1752
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_1752
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     SAVERM_1752
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_1752
SSDB
Motif
Pfam: Alpha_L_fucos GHL6
Other DBs
NCBI-ProteinID: BAC69463
NITE: SAV1752
UniProt: Q82MA8
Position
complement(2134074..2135324)
AA seq 416 aa
MSMQPWFTDAKLGIFVHWGVYAVDGVQESWSFYDDIVPHDQYMSQFDRFTAARYDPRDWA
ALFARAGARYAVLTSRHHDGVALWDTAHGNLNVGRDLISGYADALRERGLKVGLYYSHSD
WNHPDYASTRKPGRPPELADNRYSEVAAEYEDLAAWERFIAYRDGQIRELTSRYKPDLMW
FDGEWDRSEEQWRIPELAALIRSEVPDVVFNARMLSEGDYATPEQGAPVVPPQGPWELCL
TINDSWGFQHHDHNHKSVTQLIRYFTETIGGGGNLLLDVGPKEDGTIPAEQVERLEGLGD
WIAKHAEAVYGTVRGLPAGHHYGPSTLSADRRTLYLTLFDAPRAEIGVRGMAGTVRRVTV
LGSGTELAHRVIGGLHEAPGVLWIEPPAAADLDPHATVLAVELDGELELYRGPGRF
NT seq 1251 nt   +upstreamnt  +downstreamnt
gtgtccatgcagccgtggttcaccgacgccaagttggggatcttcgtccactggggcgtc
tacgccgtcgacggcgtccaggaatcgtggtcgttctacgacgacatcgtgccgcacgac
cagtacatgtcccagttcgaccgcttcaccgccgcccgctacgacccgcgcgactgggcg
gcgctgttcgcccgtgccggcgccaggtacgcggtcctgaccagccgccaccacgacggc
gtcgccctgtgggacaccgcccacggcaacctgaacgtcggccgggacctgatatccggc
tacgccgacgcactgcgcgagcggggcctcaaggtcggcctctactactcgcactcggac
tggaaccaccccgactacgcctccacgcgcaagccgggacgcccgccggagctggcggac
aaccgctactccgaggtcgccgccgagtacgaggacctggccgcctgggagcggttcatc
gcctaccgagacggccagatccgcgaactcaccagccgctacaagcccgacctcatgtgg
ttcgacggcgagtgggaccgcagtgaggagcagtggcgcatccccgaactcgccgcgctc
atccgctccgaggtgccggacgtcgtcttcaacgcccgcatgctcagcgagggcgactac
gcgacccccgagcagggcgctcccgtcgtgccgccccagggcccctgggagctgtgcctg
acgatcaacgactcctggggcttccagcaccacgaccacaaccacaaatcggtcacccag
ctgatccgctacttcaccgagacgatcggcggcggcggcaatctgctcctcgacgtcggt
ccgaaggaggacggcaccatcccggccgaacaggtcgagcgcctcgagggcctcggcgac
tggatcgccaagcacgcggaggccgtctacgggaccgtgcgcggactgcccgcgggccac
cactacgggccgagcaccctctcggcggaccgccgcacgctgtatctgaccctcttcgac
gcaccgcgcgccgagatcggcgtacgcggcatggcgggcacggtgcgccgggtcacggtg
ctcggcagcgggaccgagctggcccaccgggtcatcggcgggctgcacgaggcaccgggc
gtgctctggatcgaaccgccggccgcggccgacctcgacccgcacgccacggtgctggcc
gtcgaactggacggcgagctggagctgtaccgcgggccgggccgcttctga

DBGET integrated database retrieval system