KEGG   Streptomyces avermitilis: SAVERM_1791
Entry
SAVERM_1791       CDS       T00126                                 
Symbol
ribA2
Name
(GenBank) putative GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
sma  Streptomyces avermitilis
Pathway
sma00740  Riboflavin metabolism
sma00790  Folate biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01240  Biosynthesis of cofactors
sma02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAVERM_1791 (ribA2)
   00790 Folate biosynthesis
    SAVERM_1791 (ribA2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_1791 (ribA2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SAVERM_1791 (ribA2)
SSDB
Motif
Pfam: GTP_cyclohydro2
Other DBs
NCBI-ProteinID: BAC69502
NITE: SAV1791
UniProt: Q82M69
Position
complement(2187813..2188505)
AA seq 230 aa
MTENFGVLGGTAHLSGVERVVNAPLPTVYGDFHAVGYLDHDRGEEQVALVYGEIGDIGGL
GGVRGAGEEGVLTRLHSECLTGDAFGSRHCECGPQLTTALREIVAAGRGILVYLRGHEGR
GIGLLAKLRAMKLQAEGLDTVEANLALGLPVDARDYGVAAKILHDLGVRSVRLLSNNPRK
LESLLQHGINVVEQVPLLIPPCEENITYLRTKRERLDHILPHLDAVARSS
NT seq 693 nt   +upstreamnt  +downstreamnt
atgacagaaaactttggcgtactcggcgggactgcgcatctctcaggtgtcgaacgagtc
gtgaatgcccccctgcccaccgtgtacggcgatttccatgccgtcggttacctcgaccac
gatcgcggagaggagcaagtggccctggtgtacggcgagatcggtgacatcgggggcctc
ggcggtgtgcgtggcgccggggaggagggggtgctcacccggctccattcggaatgcctg
acaggggacgccttcgggtccaggcactgcgagtgcggcccccaactcaccaccgccctg
cgggagatcgtcgccgcggggcgcggcatcctcgtctacctccgcggccacgagggccgg
gggatcggcctgctcgccaagctgcgcgcgatgaagctccaggcggaggggctggacacc
gtggaggcgaacctcgccctcggcctcccggtggacgcccgtgactacggggtggcggcg
aagatcctgcacgacctcggggtgaggtccgtacgcctgctctccaacaacccgcgcaaa
ctggagtcgctgctccagcacggcatcaacgtcgtcgaacaggttccgctgctgataccg
ccgtgcgaggagaacatcacctatctgcgcaccaagcgggagcggctcgaccacatcctg
ccgcacctggacgccgtggcccgctcctcctga

KEGG   Streptomyces avermitilis: SAVERM_4121
Entry
SAVERM_4121       CDS       T00126                                 
Symbol
ribA3
Name
(GenBank) putative GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
sma  Streptomyces avermitilis
Pathway
sma00740  Riboflavin metabolism
sma00790  Folate biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01240  Biosynthesis of cofactors
sma02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAVERM_4121 (ribA3)
   00790 Folate biosynthesis
    SAVERM_4121 (ribA3)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_4121 (ribA3)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SAVERM_4121 (ribA3)
SSDB
Motif
Pfam: GTP_cyclohydro2
Other DBs
NCBI-ProteinID: BAC71833
NITE: SAV4121
UniProt: Q82FY1
Position
5054141..5054848
AA seq 235 aa
MRDLPSATVRTRVTVPLRFGDGYTVTGELVTFHGLADGQEHVAVVLGEPGPNPLVRLHSE
CLTGDVFGSARCDCGPQLREAVERIADRGGVLLYLRQEGRGIGLYNKLDAYALQDQGLDT
YEANAALGLPEDGRDYTAAAQMLGALGIDALDLLSNNPDKAGQLRDLGLTVTDRVPTGVF
TTAQNVRYLRAKVVHTQHTLPLTELTELTERAERAGLAKLTERTGLTEMTELTAG
NT seq 708 nt   +upstreamnt  +downstreamnt
atgcgtgatcttccgagcgccaccgtgcgcacccgcgtcaccgtcccgctgcgtttcggc
gacggctacacggtcaccggcgaactggtgaccttccacggcctggccgacggccaggaa
cacgtggccgtcgtactcggcgagcccggcccgaacccattggtgcgactgcactccgaa
tgcctgaccggagacgtcttcggctcggcccgctgcgactgcggcccgcagctgcgcgag
gcggtggagcggatagccgaccgcggcggtgtcctgctctacctccgccaggaaggccgg
ggcatcggcctctacaacaagctcgacgcgtacgccctccaggaccagggcctggacacg
tacgaggcgaacgcggccctcggcctgcccgaggacggccgcgactacacggcggccgcg
cagatgctcggcgccctcggcatcgacgccctcgacctgctctccaacaaccccgacaag
gcgggccaactgcgcgacctgggcctcacggtcaccgaccgcgtcccgacgggcgtcttc
accaccgcccagaacgtccgctatctgcgcgccaaggtcgtccacacccagcacacactg
ccgctgacggaactgacggagctcaccgagcgcgcggagcgggccggactggcgaagctc
accgaacggacgggcctgacggagatgacggaactgacggcaggctga

KEGG   Streptomyces avermitilis: SAVERM_545
Entry
SAVERM_545        CDS       T00126                                 
Symbol
ribA4
Name
(GenBank) putative GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
sma  Streptomyces avermitilis
Pathway
sma00740  Riboflavin metabolism
sma00790  Folate biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01240  Biosynthesis of cofactors
sma02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAVERM_545 (ribA4)
   00790 Folate biosynthesis
    SAVERM_545 (ribA4)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_545 (ribA4)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SAVERM_545 (ribA4)
SSDB
Motif
Pfam: GTP_cyclohydro2
Other DBs
NCBI-ProteinID: BAC68255
NITE: SAV0545
UniProt: Q82QG1
Position
complement(690137..690814)
AA seq 225 aa
MRDSRNATASSDSRNPTGLSATTVRTRVTVPLRFGDGCTVTADLATFHHLADGQEHVAVI
LGEPAAGRPPLVRLHSECLTGDVFGSARCDCGPQLREALERIADRGGVLLYLRQEGRGIG
LYNKLDAYALQDQGLDTYEANTTLGLPEDARDYTAAAQMLAALGIFELDLLSNNPDKAAQ
LRTLGLTVTQHVPTGVFTTAHNIRYLRTKVVRTQHTLPLTELTVG
NT seq 678 nt   +upstreamnt  +downstreamnt
atgcgcgactcacgcaacgccaccgcatccagtgacagcaggaatccgacaggcctgtcg
gcaaccacggtgcgcacccgcgtgacggtcccactccgcttcggcgacggctgtacagtg
accgccgacctcgccaccttccaccacctcgccgacgggcaggaacacgtggccgtcatc
ctcggcgaacccgccgctggccggcccccgctggtgcgcctgcactccgagtgcctgacc
ggcgacgtcttcggctcggcccgctgcgactgcggcccccagctgcgcgaggcgctcgag
cgcatcgccgaccgcggaggcgtcctgctctacctccgccaggagggacgcggcatcggc
ctctacaacaagctcgacgcctacgccctccaggaccagggcctcgacacctacgaggcc
aacacgaccctcggcctccccgaggacgcccgcgactacaccgccgccgcgcagatgctc
gccgccctaggcatctttgagctggacctgctgtccaacaatccggacaaggcggcccag
ctgcgcaccctgggcctaacggtgacccagcacgttcccacgggcgtgttcaccacggcc
cacaacatccgctacctccgtaccaaggtggtccgcactcagcacacactgccgctgacg
gaactgacggtgggctga

KEGG   Streptomyces avermitilis: SAVERM_6904
Entry
SAVERM_6904       CDS       T00126                                 
Symbol
ribA1
Name
(GenBank) putative GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase (dhbp synthase)
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
sma  Streptomyces avermitilis
Pathway
sma00740  Riboflavin metabolism
sma00790  Folate biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAVERM_6904 (ribA1)
   00790 Folate biosynthesis
    SAVERM_6904 (ribA1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SAVERM_6904 (ribA1)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SAVERM_6904 (ribA1)
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-ProteinID: BAC74615
NITE: SAV6904
UniProt: Q827M0
Position
8237732..8239021
AA seq 429 aa
MTTAPILYSTDNIEDFALDPVERAIADIAAGRPVVVVDDEDRENEGDLVIAAEKATPEIV
AFMMSECRGLICAPMEGGELDRLQLPQMVDHNTESMRTAFTVSVDASGAHGVTTGISAAD
RATTLRLLAQGEAGAADFVRPGHIFPLRAKPGGVLVRNGHTEAAVDLARLAGLRPAGAIV
EIAGEDGHMLRLPELIPFARKHGLTIISIEDLIAYRQSSEPTVRREAEVHLPTAFGEFTA
YGYRSTVDGVEHVALVHGEIGDGEGVLVRVHSECLTGDVFHSLRCDCGPQLEASLERIRS
EGRGVVVYLRGHEGRGIGLVSKLRAYELQERGRDTLDANLELGLPADARDYAAGAQILED
LGVRSLRLMTNNPDKTDALLRHGLKVTGREPMPVQAGEHNLRYLTTKRDRMGHDLPWLDT
VPVSTCGNQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaccacggcgccgatcctgtacagcacggacaacatcgaggacttcgcgctcgacccg
gtcgagcgggccatcgccgacatcgcggccggccgcccggtcgtggtcgtcgacgacgag
gaccgggagaacgagggcgacctcgtcatcgccgccgagaaggcgacccccgaaatcgtc
gccttcatgatgagcgagtgccgcggcctgatctgcgcgcccatggagggcggcgaactg
gaccgcctccagctgccgcagatggtcgaccacaacaccgagtcgatgcggacggcgttc
accgtgtcggtcgacgcgagcggcgcgcacggggtcaccaccgggatctccgccgccgac
cgcgcgaccacgctccggctgctcgcccagggagaggcgggggccgccgacttcgtccgc
cccggccacatcttcccgctgcgcgccaagcccggcggggtcctcgtccgcaacggccac
accgaggccgccgtcgacctcgcccgcctcgcgggtctgcgaccggccggcgcgatcgtc
gagatcgccggcgaggacggccacatgctgcggctgccggagctgatcccgttcgcccgc
aagcacggcctgacgatcatctccatcgaggacctgatcgcctaccgccagagctccgag
cccaccgtccggcgcgaggccgaggtccatctgcccaccgccttcggcgagttcacggcc
tacggctaccgctccaccgtcgacggcgtcgaacacgtcgccctggtccacggcgagatc
ggcgacggcgagggcgtactcgtccgcgtccactccgaatgcctcaccggcgacgtcttc
cactcgctgcgctgcgactgcggcccccagctggaggcctccctggagcgcatccgcagc
gagggccgcggcgtcgtggtctacctccgcggacacgagggacgcggcatcgggctggtg
tccaagctgcgcgcgtacgagctccaggagcgcggccgcgacaccctcgacgccaacctg
gaactcggcctgcccgccgacgcccgcgactacgcggccggtgcgcagatcctggaggac
ctcggcgtccgcagcctgcggctgatgaccaacaaccccgacaagaccgacgcgctcctg
aggcacggcctcaaggtcaccgggcgcgagccgatgcccgtacaggcgggcgagcacaac
ctccggtacctgaccaccaagcgggaccggatgggccacgatctgccctggctggacacg
gtccccgtgtccacctgcggcaaccagtaa

DBGET integrated database retrieval system