KEGG   Streptomyces avermitilis: SAVERM_1842
Entry
SAVERM_1842       CDS       T00126                                 
Symbol
neuA1
Name
(GenBank) putative neuraminidase, secreted
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SAVERM_1842 (neuA1)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_1842 (neuA1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SAVERM_1842 (neuA1)
SSDB
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 Laminin_G_2 BNR Laminin_G_1 DUF4185
Other DBs
NCBI-ProteinID: BAC69553
NITE: SAV1842
UniProt: Q82M18
Position
2256926..2258803
AA seq 625 aa
MPSTLRARIASTLTAVLTTAALLALPSPAGAEQATDTGEFEQQVLFKASQDPGYACFRIP
AVVKTTDGTLLAFAEGRVLNCGDAADIDIVLKRSTDGGRTWGPLQVVNEGGGDTHGNPAP
VVDRETGRIVLAETYNTGRTDSAGCTVPCDRTPHLQYSDDDGLTWSRPRDLSDEILPPEW
NSWYATGPVHGIQLTRGRHAGRLVLGVNTETWDGSRVSANHAALITSDDGGDHWRIGATD
SWPIAADGTFRQKPSEMTLAERTDGSVLVSGREQDGTDLGHRTQAVSRDGGSSFTAPFRD
LPDLYTPQVQGSSLRLGDRLLLACPGDPDRRRTMTIRSSYDGGRTWDSVDRGTVVTTDWS
GYSDLVRVGRDTVGLMYEGGAVDARDEIRFARFTEDWLKPRRGPDPTTPDLAPHAKGAAV
LGGAEQTEGVFGGALDFDGADDAVRLPYRAELPLGTKDFTASLWFRYTAATGEQPLLWMG
GIGTSQPQVWLRGEPASNRVQGLITVRDGASAPQSAFVRTTGAYNDGQWHHLALRRGGGA
LTLFLDGTPISTADVPGSVSRNSPFGVHIGQRMDSRAYFTGSIDEVRVYGRALSDAEITG
LRTDNEASARDTVLRLPMDRVSGSH
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgccgtcaactctccgtgcacgtatcgcatcgaccctgaccgccgtgctcaccaccgcc
gcactactggccctgccgagccccgcgggggccgaacaggcgacggacacgggtgagttc
gagcaacaggtgctcttcaaggcgtcccaggatcccggatacgcctgcttccgcataccg
gccgtcgtgaagacgaccgacggcaccctcctggcgttcgccgagggccgcgtcctcaac
tgcggtgacgcggccgacatcgacatcgtcctcaagcgctccaccgacggcggccgcacc
tggggcccgctccaggtggtcaacgagggcggcggggacacccacggcaacccggcgccc
gtagtggaccgcgagaccggccgcatcgtcctggccgagacgtacaacacgggccgtacg
gacagcgccggctgtaccgtcccgtgcgaccgcacaccgcacctccagtacagcgacgac
gacggcctcacctggtcccggccgcgcgacctgagcgacgagatcctcccgccggagtgg
aactcctggtacgccaccggacccgtgcacggcatccagctgacccggggcagacatgcg
ggccggctcgtcctcggcgtcaacaccgagacatgggacggcagtcgggtcagcgcgaac
cacgccgcgctcatcaccagcgacgacggcggcgaccactggaggatcggcgccacggac
tcgtggccgatcgccgcggacggcacgttccgtcagaagccgtccgagatgacgctggcc
gagcgcacggacgggtccgtcctggtcagcgggcgcgagcaggacggcaccgacctcgga
caccgcacccaggccgtcagccgcgacggcggctccagcttcaccgcgcccttccgtgat
ctgccggacctgtacacgccccaggtccagggctcctcgctgcgcctgggcgaccggctg
ctgctcgcctgccccggcgacccggaccgccggcggaccatgacgatccgctcctcgtac
gacggcggacgcacctgggacagcgtcgaccgcggcacggtcgtcaccacggactggtcg
ggctactcggacctggtgcgcgtcggccgggacaccgtgggcctgatgtacgagggcggt
gcggtcgacgcgcgggacgagatccgcttcgcccgcttcaccgaggactggctgaaaccc
cgccgcggccccgacccgacaacgcccgacctggccccgcacgccaagggcgccgcggtc
ctcgggggcgccgagcagacggagggcgtgttcggcggcgcgctcgacttcgacggcgcc
gacgacgccgtacgcctgccgtaccgtgccgaactcccgctcgggacaaaggacttcacg
gcgtccctctggttccgttacaccgccgcgaccggcgagcagcccctgctgtggatgggc
gggatcgggacctcgcagccacaggtgtggctgcgcggcgagcccgcgtcgaaccgcgtc
cagggtctgatcaccgtccgcgacggcgcctcggccccgcagtccgcgttcgtgcgcacg
acgggcgcgtacaacgacggccagtggcaccatctcgcgctgcgccgtggcggcggagcg
ctcacgctgttcctcgacggtacgccgatcagcaccgcggatgtgcccgggtccgtcagc
cgcaactcgccgttcggtgtgcacatcggtcagcggatggacagccgggcgtacttcacc
ggatccatcgacgaagtgcgcgtctatggacgggcgttgagcgacgccgagatcacgggc
ctgcgcacggacaacgaggcgtcggcccgggacaccgtcctgcggctgcccatggaccgg
gtgagcggcagccactaa

KEGG   Streptomyces avermitilis: SAVERM_5606
Entry
SAVERM_5606       CDS       T00126                                 
Symbol
neuA2
Name
(GenBank) putative neuraminidase, secreted
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SAVERM_5606 (neuA2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_5606 (neuA2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SAVERM_5606 (neuA2)
SSDB
Motif
Pfam: BNR_2 BNR
Other DBs
NCBI-ProteinID: BAC73318
NITE: SAV5606
UniProt: Q82BU8
Position
6781453..6782664
AA seq 403 aa
MSVRSRTTLLAAAVGLVTALAVTGTAGPAAAAPPPSRGCTSSVPYTAGQYGYDTYRIPAT
LRTRAGTLLAFAEGRRGGAGDTGNIDVVLRRSFDGGCAWGPLTVVAAGRGDTRGNPAPVV
DSRTGRIVLVTSYNGGAVTEAQIMRGEVTPEQSRRVFVQTSRDDGRHFSAPRDITAQVKP
ANWRWYATGPGHAVALTRGPHAGRLVVPANHSAAPPEGSADTGREARYYGAHAIYSDDGG
LTWRLGFVDDSYDGVDNANENAAAELPDGRLYFSARDQNGTSAGNRLDTYSGDGAQTLDR
PYAVQPTLNDVPVVQGSVLQLTGNGAPLLFSGPSVPTARRSMAIRRSEDGGGTFVTVKTL
SALPAAYSDLVQVSATKVGILYETGVAGPYDSIEFRRVPVGEL
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgtccgtcaggagccgtacgaccctgctcgccgccgcggtggggctggtgaccgccctc
gcggtcaccggcacggcgggcccggccgcggccgccccgccgccctcccgcggctgcacg
tcctccgtgccgtacaccgcgggccagtacggctacgacacctaccgcatcccggcgacg
ctcaggacgagggccggcacgctcctcgccttcgcggagggacggcgaggcggcgcgggc
gacaccggcaacatcgacgtggtcctcagacgctccttcgacggtggctgcgcctggggc
ccgctgacggtcgtcgcggcgggccggggcgacacccggggcaaccccgcgccggtggtg
gattcgaggaccggccggatcgtcctggtcacgtcctacaacggcggtgccgtgaccgag
gcgcagatcatgcgcggggaggtgacccccgagcagagccgccgcgtcttcgtccagacg
agccgcgacgacggccggcacttctccgcgccccgtgacatcacggcgcaggtcaagccg
gcgaactggcggtggtacgcgaccggcccgggccacgcggtggccctcacgcggggcccg
cacgccggccgcctcgtcgtccccgccaaccactccgccgcgccgcccgagggttcggcc
gacaccgggcgggaggccaggtactacggcgcgcacgcgatctacagcgacgacggcggg
ctcacctggcggctcggcttcgtcgacgactcctacgacggcgtcgacaacgccaacgag
aacgccgccgccgaactgcccgacggacggctctacttcagcgcccgcgaccagaacggc
acgagcgccggcaaccggctggacacgtactccggcgacggcgcgcagaccctggaccgc
ccgtacgccgtccagcccaccctgaacgacgtcccggtcgtccagggcagcgtgctgcaa
ctgacggggaacggggcgcccctgctcttctccgggccctccgtgccgaccgcccgccgg
tcgatggcgatccggcggagcgaggacgggggcgggacgttcgtgacggtgaagaccctg
tcggcactgccggcggcgtactcggacctggtgcaggtgagcgccacgaaggtcgggatc
ctgtacgagaccggggtggccgggccctacgactcgatcgagttccggcgggtgccggtg
ggggagctgtga

KEGG   Streptomyces avermitilis: SAVERM_5934
Entry
SAVERM_5934       CDS       T00126                                 
Symbol
neuA3
Name
(GenBank) putative neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SAVERM_5934 (neuA3)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_5934 (neuA3)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SAVERM_5934 (neuA3)
SSDB
Motif
Pfam: BNR_2 BNR_3
Other DBs
NCBI-ProteinID: BAC73646
NITE: SAV5934
UniProt: Q82AX1
Position
7144755..7145828
AA seq 357 aa
MTEASTPFRGGREGYASYRIPAVVATGVGTLLAFCEGRVDSAHDHGNIDIVLKRSGDGGR
TWGPLQAVAKNGDNLAGNPAPVVLDTGRVLLVHVRSAAGASEDAILRGKVKAADGRRVWV
QHSDDDGLTWSGPREITGQVRKANWRWYATTPGHALQLTTGRVVVPGNHTVPPTGTDNGT
EAKYNSGHCLLSDDRGASWYLGYLDENTNGYINVNETTATELPDGRVYFNTRNDSPSPGN
RADAYSKDGGKTLVKPFRPQAGLTTPVVQGSVLQLRDPDLLLYSGPADPAFRALMTVRAS
ADGGTTWRTAHPLDGLPAAYSDLVRVDQDTVGLLYETGDFGAYETITFRRIPVTALT
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgacagaagccagtacaccgttccgcggcggccgcgaaggctatgccagttaccggatc
ccggcagtcgtcgcgaccggcgtgggaaccctgctcgccttctgcgagggccgggtcgac
tccgcgcacgaccacggcaacatcgacatcgtgctgaagcggtcgggcgacggcggccgc
acctggggcccgctccaggccgtcgcgaagaacggcgacaacctcgcgggcaacccggcc
cccgtcgtcctcgacaccggccgggtcctcctcgtccatgtccgcagcgcggccggcgcg
agcgaggacgccatcctgcgcggcaaggtgaaggccgccgacgggcggcgcgtatgggtc
cagcacagcgacgacgacggactgacctggtcgggcccgcgtgagatcaccggacaggtg
cgcaaggcgaactggcgttggtacgccaccacacccgggcacgccctccagctcaccacc
ggccgcgtcgtcgtacccggcaaccacaccgtcccgcccaccggcacggacaacggcacg
gaggccaagtacaacagcgggcactgcctgctcagcgacgaccgcggcgcgagctggtac
ctcggctacctcgacgagaacaccaacggctacatcaacgtgaacgagacgacggccacc
gaactccccgacgggcgggtctacttcaacacccgcaacgactccccgtcccccggcaac
cgtgccgacgcgtactcgaaggacggcgggaagaccctggtcaagccgttccgcccgcag
gccgggctcaccacccccgtcgtccagggcagcgtcctccagctccgcgaccccgatctg
ctcctgtactccgggcccgccgaccccgccttccgcgccctgatgaccgtccgcgccagt
gcggacggcggcaccacctggcgcaccgcccacccgctcgacggcctgcccgccgcgtac
tccgatctcgtacgcgtcgaccaggacaccgtcggcctgctctacgagacgggtgacttc
ggcgcctacgagacgatcaccttccgtcgcatcccggtgacggccctcacgtga

DBGET integrated database retrieval system