KEGG   Streptomyces avermitilis: SAVERM_1949
Entry
SAVERM_1949       CDS       T00126                                 
Symbol
dht
Name
(GenBank) putative dihydropyrimidinase
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00240  Pyrimidine metabolism
sma00410  beta-Alanine metabolism
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAVERM_1949 (dht)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_1949 (dht)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_1949 (dht)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_1949 (dht)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.2  dihydropyrimidinase
     SAVERM_1949 (dht)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_1949 (dht)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3 Urease_alpha Usp DHOase
Other DBs
NCBI-ProteinID: BAC69660
NITE: SAV1949
UniProt: Q82LR1
Position
complement(2384296..2385696)
AA seq 466 aa
MSRTVIRGGLVVTASDEIHADVLIEDGRIVALAASGTPAAEAWTAERTIDATGKYVIPGG
VDAHTHMELPFGGTFASDSFETGTRAAAWGGTTTIVDFAVQSVGHSLREGLDAWNAKADG
KCAIDYAFHMIVSDVNNETLKEMDLLVEEGVTSFKQFMAYPGVFYSDDGQILRAMQRSAE
NGGLIMMHAENGIAIDVLVEQALARGETDPRYHGEVRKALLEAEATHRAIKLAQVAGAPL
YVVHVSAQEAVAELARARDEGLNVFGETCPQYLFLSTDNLAEPDFEGAKYVCSTPLRPKQ
HQAALWRGLRTNDLQVVSTDHCPFCFVGQKELGRGDFSKIPNGLPGVENRMDLLHQAVVD
GHISRRRWIEIACATPARMFGLYPKKGTIAPGADADVVIYDPHAEQIISAETHHMNVDYS
AYEGRRVTGRVETVLSRGEPVITEREFTGRAGHGVYTPRSTCQYLN
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgagccgtaccgtcatccgcggtggcctcgtcgtcaccgcgtccgacgagatccacgcc
gacgtcctgatcgaggacggccgcatcgtcgccctcgccgcctcgggcaccccggccgcc
gaggcctggacggccgagcggaccatcgacgccaccggaaagtacgtgattccgggcgga
gtcgacgcccacacccacatggaactgcccttcggcggcaccttcgcctccgactccttc
gagacgggtacgcgggccgcggcctggggcggtacgacgacgatcgtcgacttcgcggtg
cagagcgtgggccattcgctgcgcgagggcctggacgcctggaacgccaaggccgatggc
aagtgcgccatcgactacgccttccacatgatcgtctcggacgtcaacaacgagacgctg
aaggagatggacctcctcgtcgaggagggcgtcacctccttcaagcagttcatggcctat
cccggcgtcttctacagcgacgacggccagatcctgcgcgccatgcagcgctccgccgag
aacggcggcctgatcatgatgcacgccgagaacggcatcgcgatcgacgtgctggtcgag
caggcgctggcccgcggtgagaccgacccccggtatcacggcgaggtccgcaaggccctg
ctggaggccgaggccacccaccgcgccatcaagctcgcgcaggtcgcgggcgctccgctg
tacgtcgtgcacgtctcggcgcaggaagcggtcgccgagctggcacgggcgcgcgacgag
ggactgaacgtcttcggcgagacctgtccgcagtacctgttcctgtcgaccgacaacctc
gccgagcccgacttcgagggcgccaagtacgtgtgcagcacgcctcttcgccccaaacag
caccaggccgcgttgtggcgcgggttgcgcaccaacgacctccaggtcgtctccaccgac
cactgccccttctgcttcgtcggccagaaggagctcggccggggcgacttctccaagatc
cccaacggtctgccgggggtcgagaaccgtatggacctgctccaccaggccgtcgtcgac
gggcacatctcgcgccgccgctggatcgagatcgcctgcgccaccccggcccggatgttc
ggcctgtacccgaagaaggggaccatcgcgccgggcgccgacgccgatgtcgtcatctac
gacccgcacgccgagcagatcatctcggccgagacgcaccacatgaacgtcgactactcg
gcgtacgagggcaggcgcgtcacgggacgggtcgagaccgtgctctcgcggggcgaaccg
gtcatcaccgagcgggagttcaccgggcgcgcggggcatggcgtctacaccccccgctcc
acctgtcagtacctgaactag

DBGET integrated database retrieval system