KEGG   Streptomyces avermitilis: SAVERM_1950
Entry
SAVERM_1950       CDS       T00126                                 
Name
(GenBank) putative hydrolase
  KO
K01431  beta-ureidopropionase [EC:3.5.1.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00240  Pyrimidine metabolism
sma00410  beta-Alanine metabolism
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAVERM_1950
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_1950
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_1950
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     SAVERM_1950
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: BAC69661
NITE: SAV1950
UniProt: Q82LR0
Position
complement(2385800..2386642)
AA seq 280 aa
MSRVIRAAVFQTAWTGDKESMIQVHEQAVRDAAAQGAQVLCFQELFYGPYFCQVQDKAFY
EYAEQIPHGPIVKRFQALARELGIVLVLPMYEEEQPGVLYNTAAVIDADGSYLGKYRKTH
IPQVEGFWEKFYFRPGNSGWPVFDTAVGRIGVYICYDRHFPEGWRALGLAGAEIVFNPSA
TSRGLSGYLWQLEQPAAAVANEYFVGAINRVGVEELGDNDFYGTSYFVDPEAQFVGEVAS
DKETELVVRDLDLAKLREVRDRWQFYRDRAPGAYGPLTAP
NT seq 843 nt   +upstreamnt  +downstreamnt
atgagcagagtgatccgcgccgccgtcttccagaccgcatggaccggcgacaaggaatcg
atgatccaggtccacgagcaggcggtccgcgacgcggccgcacagggcgcacaggtcctg
tgtttccaggagctgttctacggtccctacttctgccaggtccaggacaaggcgttctac
gagtacgccgagcagatcccgcacggcccgatcgtcaagcgcttccaggcgctggccagg
gaactgggcatcgtcctggtcctgccgatgtacgaggaggagcagcccggcgtcctctac
aacaccgcggccgtgatcgacgccgacggctcgtacctgggcaagtaccgcaagacccac
attccgcaggtcgagggattctgggagaagttctacttccgccccggcaacagcgggtgg
ccggtcttcgacaccgccgtcggcaggatcggtgtctacatctgctacgaccgtcacttc
ccggagggctggcgggcgctgggcctggcgggcgccgagatcgtgttcaacccgtcggcc
acctcgcgcggtctgtccggctacctctggcagctggagcagccggcggcggcggtcgcc
aacgagtacttcgtcggcgccatcaaccgcgtgggcgtcgaggagctgggcgacaacgac
ttctacgggacctcgtacttcgtggacccggaggcgcagttcgtcggcgaggtggcgagc
gacaaggagaccgaactcgtcgtccgcgacctggacctggccaagctgcgggaagtgcgc
gaccgctggcagttctaccgcgaccgcgccccgggcgcgtacgggcccctgaccgctccg
tag

KEGG   Streptomyces avermitilis: SAVERM_1953
Entry
SAVERM_1953       CDS       T00126                                 
Name
(GenBank) putative hydrolase
  KO
K01431  beta-ureidopropionase [EC:3.5.1.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00240  Pyrimidine metabolism
sma00410  beta-Alanine metabolism
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAVERM_1953
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_1953
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_1953
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     SAVERM_1953
SSDB
Motif
Pfam: CN_hydrolase DUF5926
Other DBs
NCBI-ProteinID: BAC69664
NITE: SAV1953
UniProt: Q82LQ7
Position
complement(2389685..2390527)
AA seq 280 aa
MAHVVRAALVQATWTGDTESMIAKHVEHAREAARQGAKVIGFQEVFNAPYFCQVQEPEHY
RWAEPVPDGPTVVRMQELARETGMVIVVPVFEVEQSGFYFNTAAVIDADGTYLGKYRKHH
IPQVKGFWEKYYFKPGNMGWPVFDTAVGKVGVYICYDRHFPEGWRQLGLNGAQLVYNPSA
TSRGLSAYLWQLEQPAAAVANEYFIAAINRVGQEEYGDNDFYGTSYFVDPRGQFVGEVAS
DKSEELVVRDLDFDVIDEVRQQWAFYRDRRPDAYEGLVRP
NT seq 843 nt   +upstreamnt  +downstreamnt
atggcccacgtcgtacgcgccgcactggtccaggcgacctggaccggtgacaccgaatcc
atgatcgccaagcatgtggagcacgcccgcgaggcggcccggcagggcgcgaaggtgatc
ggtttccaggaggtcttcaacgccccctacttctgtcaggtccaggagcccgagcactac
cgctgggccgagccggtaccggacggacccacggtggttcgtatgcaggagctcgcgcgc
gagaccggcatggtgatcgtcgtgcccgtgttcgaggtggagcagtccggcttctacttc
aacaccgcggccgtgatcgacgccgacggcacctacctgggcaagtaccgcaagcaccac
atcccccaggtgaagggcttctgggagaagtactacttcaaaccggggaacatgggctgg
cccgtcttcgacaccgcggtcggcaaggtcggcgtctacatctgctacgaccgtcacttc
ccggagggctggcggcagctcggcctcaacggcgcccagctcgtctacaacccctccgcc
acctcgcgcggtctgtccgcctacctctggcagctggagcagcccgccgcggccgtcgcc
aacgagtacttcatcgccgcgatcaaccgcgtcggccaggaggagtacggcgacaacgac
ttctacgggacgagctacttcgtcgacccgcgcgggcagttcgtgggcgaggtcgccagc
gacaagtccgaggaactcgtcgtccgtgacctcgacttcgacgtcatcgacgaagtgcgg
cagcagtgggccttctaccgcgaccgccgccccgacgcctacgaagggctggtgcggccg
tga

DBGET integrated database retrieval system