KEGG   Streptomyces avermitilis: SAVERM_1966
Entry
SAVERM_1966       CDS       T00126                                 
Symbol
xthA
Name
(GenBank) putative exonuclease
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_1966 (xthA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_1966 (xthA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     SAVERM_1966 (xthA)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     SAVERM_1966 (xthA)
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-ProteinID: BAC69677
NITE: SAV1966
UniProt: Q82LP4
Position
complement(2403970..2404758)
AA seq 262 aa
MRIATWNVNSITARLPRLLAWLESSGTDVLCIQETKTTAEQFPADALRELGYESAVHATG
RWNGVAVISRVGLEDVVRGLPGDPGFDGVQEPRALSATCGPVRVWSVYVPNGREVEHPHY
AYKLQWFEALKAAVAGDAAGSRPFAVMGDFNVAPTDDDVYDVAAFEGLTHVTPAERAALA
TLREAGLSDVVPRPLKYEHPYTYWDYRQLCFPKNRGMRIDLVYGNEPFAKAVKDAYVDRE
ERKGKGASDHAPVVVDLDVQDA
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcgcatcgccacctggaacgtgaactcgatcaccgcccgtctcccgaggctcctggcc
tggctggagagcagcggcacggacgtgctgtgcatccaggagaccaagacgaccgccgag
cagttcccggcggacgcgctgcgcgagctgggctacgagtcggcggtgcacgccacaggg
cggtggaacggcgtggcggtgatctcccgcgtcggcctcgaggacgtggtcaggggcctg
cccggcgaccccggcttcgacggcgtccaggagccccgcgcgctctccgcgacctgcggc
ccggtccgcgtctggtcggtgtacgtgccgaacggccgcgaggtggagcacccccactac
gcgtacaagctccagtggttcgaggccctcaaggcggcggtcgcgggcgacgcggcgggc
agccggccgttcgcggtgatgggcgacttcaatgtggcgccgacggacgacgacgtgtac
gacgtggccgccttcgagggcctcacccacgtcaccccggccgagcgcgccgccctggcg
acgctccgtgaggcgggcctgtccgatgtcgtcccgcgtccgctgaagtacgagcacccc
tacacgtactgggactaccgccagctctgcttccccaagaaccgcggcatgcgcatcgac
ctggtgtacggcaacgagccgttcgccaaggcggtgaaggacgcgtacgtggaccgcgag
gagcgcaagggcaagggcgcgtcggaccacgcgccggtcgtggtggacctggacgtgcag
gacgcgtag

KEGG   Streptomyces avermitilis: SAVERM_3628
Entry
SAVERM_3628       CDS       T00126                                 
Symbol
exoA
Name
(GenBank) putative exodeoxyribonuclease
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_3628 (exoA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3628 (exoA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     SAVERM_3628 (exoA)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     SAVERM_3628 (exoA)
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2 GspH
Other DBs
NCBI-ProteinID: BAC71339
NITE: SAV3628
UniProt: Q82H83
Position
complement(4483778..4484641)
AA seq 287 aa
MRASVHLCARPLSWIKYRAGVLTVTSVNVNGLRAAAKKGFVEWLAETSADVLCLQEVRAE
PDQLPAGVRAPDGWHVVHAPAAAKGRAGVSLYTRREPDRVRVGFGSAEFDGGGRYVEADL
PGVTVASLYLPSGEVGTERQDEKYRFMGEFLTHLKDLRERAAADGREVLVCGDWNIAHQE
ADLKNWRGNRKNAGFLPEEREWLGRVLSPEDGGYVDVMRALHPDVEGPYSWWSYRGRAFD
NDSGWRIDYEVATPGLAAKAVKGFVERAATHEERWSDHAPVTVVYDL
NT seq 864 nt   +upstreamnt  +downstreamnt
atgcgcgcaagcgtacatctatgcgcacgtccgctctcctggattaagtatcgtgccggg
gtgctcactgtgacctctgtgaatgtgaacggactccgcgccgccgcgaagaagggcttc
gtggagtggctcgcggagacctccgcggacgtgctgtgccttcaggaggtacgggccgag
ccggaccagctgcccgcgggcgtgcgcgcgcccgacggctggcacgtcgtccacgcgccc
gccgccgccaaggggcgcgcgggcgtctccctctacacccgccgcgagcccgatcgcgtc
cgcgtcggcttcgggtcggcggagttcgacggcggcggccggtacgtcgaggccgacctg
cccggcgtcaccgtcgccagcctctacctgccctccggcgaggtcggcaccgaacggcag
gacgagaagtaccggttcatgggggagttcctcacccacctgaaggacctgcgcgagcgc
gccgccgccgacggccgcgaggtcctcgtgtgcggcgactggaacatcgcccaccaggag
gccgacctcaagaactggcgcggcaaccggaagaacgcggggttcctgccggaggaacgg
gagtggctgggccgcgtcctctcgcccgaggacggcggatacgtcgacgtcatgcgagcc
ctgcacccggacgtcgaaggcccctattcgtggtggtcgtaccgggggcgggccttcgac
aacgattcagggtggaggatcgattacgaggtcgccacgccgggcctcgccgccaaggcg
gtcaagggcttcgtggagcgggcggccacgcacgaggagcgctggtcggaccacgccccg
gtgacggtggtctacgacctctga

DBGET integrated database retrieval system