KEGG   Streptomyces avermitilis: SAVERM_2131
Entry
SAVERM_2131       CDS       T00126                                 
Symbol
cysD1
Name
(GenBank) putative sulfate adenylyltransferase subunit 2
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00230  Purine metabolism
sma00261  Monobactam biosynthesis
sma00450  Selenocompound metabolism
sma00920  Sulfur metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Module
sma_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SAVERM_2131 (cysD1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_2131 (cysD1)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAVERM_2131 (cysD1)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SAVERM_2131 (cysD1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     SAVERM_2131 (cysD1)
SSDB
Motif
Pfam: PAPS_reduct ATP_bind_3 QueC Diphthami_syn_2
Other DBs
NCBI-ProteinID: BAC69842
NITE: SAV2131
UniProt: Q81ZI7
Position
2597816..2598751
AA seq 311 aa
MTTAATASQETDSPYALSHLDALESEAVHIFREVAGEFERPVILFSGGKDSIVMLHLALK
AFAPAAIPFTLLHVDTGHNFPEVLAYRDRVVAAHGLRLHVASVQDYIDRGVLRERPDGTR
NPLQTVPLTEAIQQHRFDAVFGGGRRDEEKARAKERVFSLRDEFSQWDPRRQRPELWNLY
NGRHAPGEHVRVFPLSNWTELDVWQYIAREHIELPEIYFAHEREVFQRSHMWLTAGDWGG
PKDGETVEKRRVRYRTVGDMSCTGAVDSDATTLDAVITEIAASRLTERGATRADDKMSEA
AMEDRKREGYF
NT seq 936 nt   +upstreamnt  +downstreamnt
atgacgaccgcagccaccgcttcccaggagaccgacagcccgtacgcgctctcgcatctg
gacgcgctggagtcggaggccgtccacatcttccgcgaggtggcgggcgagttcgaacgg
ccggtgatcctgttctccggcggcaaggactccatcgtcatgctgcacctggcactgaag
gccttcgcccccgcggcgatccccttcaccctgctgcacgtggacaccggacacaacttc
cccgaagtcctcgcataccgcgaccgtgtggtcgccgcacacggactgcgcctccatgtg
gcctccgtacaggactacatcgaccgcggtgtactgcgcgaacgccccgacggcacccgc
aaccccctgcagaccgtgcccctgaccgaagccatccagcagcaccgcttcgacgccgtc
ttcggcggcggccgacgcgacgaggaaaaggcccgcgccaaagaacgcgtcttctccctg
cgcgacgagttctcccagtgggacccccgccgccagcgccccgaactgtggaacctctac
aacggccgccacgcccccggcgaacacgtccgcgtcttcccgctctccaactggaccgag
ctggacgtatggcagtacatcgcccgcgaacacatcgaactccccgagatctacttcgcc
cacgaacgcgaggtcttccagcggtcccacatgtggctgaccgccggtgactggggcggc
cccaaggacggcgagactgtcgagaagcgccgggtccgctaccgcaccgtcggcgacatg
tcctgcaccggcgccgtcgactccgacgccaccacgctggacgccgtgatcaccgagatc
gccgcctcccggctcaccgaacgcggcgccacccgcgccgacgacaagatgtccgaggcc
gcgatggaagaccgcaagcgcgaggggtacttctag

KEGG   Streptomyces avermitilis: SAVERM_2313
Entry
SAVERM_2313       CDS       T00126                                 
Symbol
cysD2
Name
(GenBank) putative sulfate adenylyltransferase subunit 2
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00230  Purine metabolism
sma00261  Monobactam biosynthesis
sma00450  Selenocompound metabolism
sma00920  Sulfur metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Module
sma_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SAVERM_2313 (cysD2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_2313 (cysD2)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAVERM_2313 (cysD2)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SAVERM_2313 (cysD2)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     SAVERM_2313 (cysD2)
SSDB
Motif
Pfam: PAPS_reduct ATP_bind_3 QueC Diphthami_syn_2
Other DBs
NCBI-ProteinID: BAC70024
NITE: SAV2313
UniProt: Q81ZI7
Position
2815298..2816233
AA seq 311 aa
MTTAATASQETDSPYALSHLDALESEAVHIFREVAGEFERPVILFSGGKDSIVMLHLALK
AFAPAAIPFTLLHVDTGHNFPEVLAYRDRVVAAHGLRLHVASVQDYIDRGVLRERPDGTR
NPLQTVPLTEAIQQHRFDAVFGGGRRDEEKARAKERVFSLRDEFSQWDPRRQRPELWNLY
NGRHAPGEHVRVFPLSNWTELDVWQYIAREHIELPEIYFAHEREVFQRSHMWLTAGDWGG
PKDGETVEKRRVRYRTVGDMSCTGAVDSDATTLDAVITEIAASRLTERGATRADDKMSEA
AMEDRKREGYF
NT seq 936 nt   +upstreamnt  +downstreamnt
atgacgaccgcggccaccgcttcccaggagaccgacagcccgtacgcgctctcgcatctg
gacgcgctggagtcggaggccgtccacatcttccgcgaggtggcgggcgagttcgaacgg
ccggtgatcctgttctccggcggcaaggactccatcgtcatgctgcacctggcactgaag
gccttcgcacccgcggcgatccccttcaccctgctgcacgtggacaccggacacaacttc
cccgaggtcctcgcataccgcgaccgtgtggtcgccgcacacggactgcgcctgcatgtg
gcctccgtacaggactacatcgaccgcggtgtactgcgcgaacgccccgacggcacccgc
aaccccctgcagaccgtgcccctgaccgaagccatccagcagcaccgcttcgacgccgtc
ttcggcggcggccgacgcgacgaggaaaaggcccgcgccaaagaacgcgtcttctccctg
cgcgacgagttctcccagtgggacccccgccgccagcgccccgaactgtggaacctctac
aacggccgccacgcccccggcgaacacgtccgcgtcttcccgctctccaactggaccgag
ctggacgtatggcagtacatcgcccgcgaacacatcgaactccccgagatctacttcgcc
cacgaacgcgaggtcttccagcggtcccacatgtggctgaccgccggtgactggggcggc
cccaaggacggcgagactgtcgagaagcgccgggtccgctaccgcaccgtcggcgacatg
tcctgcaccggcgccgtcgactccgacgccaccacgctggacgccgtgatcaccgagatc
gccgcctcccggctcaccgaacgcggcgccacccgcgccgacgacaagatgtccgaggcc
gcgatggaagaccgcaagcgcgaggggtacttctag

KEGG   Streptomyces avermitilis: SAVERM_2314
Entry
SAVERM_2314       CDS       T00126                                 
Symbol
cysN2
Name
(GenBank) putative sulfate adenylyltransferase large subunit
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00230  Purine metabolism
sma00261  Monobactam biosynthesis
sma00450  Selenocompound metabolism
sma00920  Sulfur metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Module
sma_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SAVERM_2314 (cysN2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_2314 (cysN2)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAVERM_2314 (cysN2)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SAVERM_2314 (cysN2)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     SAVERM_2314 (cysN2)
SSDB
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2
Other DBs
NCBI-ProteinID: BAC70025
NITE: SAV2314
UniProt: Q82KQ9
Position
2816236..2817456
AA seq 406 aa
MTSTTTATTDTLRFATAGSVDDGKSTLVGRLLHDSKSVLADQLEAVEQVSRSRGQDAPDL
ALLTDGLRAEREQGITIDVAYRYFATARRRFILADTPGHVQYTRNMVTGASTADLAVILV
DARNGVIEQTRRHAAVAALLRVPHIVLAVNKMDLVGYEEKEFDRIVEDFAGHAAELDLPG
FTPVPVSALCGDNVVERSAHMDWYAGPALLDLLETVPVGAESAGAPARFPVQYVIRHDGV
RHYAGQLVSGSLRVGDRVTVHPSGETSEITGIDVLGTTARAAYAPQSLTLRLAGQRDIAR
GDMITAGPDAPELTRDVRAAVCHLADRPLRIGDRVLVKHTTRTVKALVKDLAGATELTAN
DLGRIALRTAEPLALDDYARVRRTGAFLLVDPADGATLTAGMADLS
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaccagcaccaccaccgccaccaccgacaccctgcgcttcgcgaccgccggttccgtc
gacgacggcaagtccacgctggtcgggcgtctgctgcacgactccaagtcggtcctcgcg
gaccagctggaggccgtggagcaggtgtcgcgcagccgcggccaggacgctcccgacctg
gccctcctcaccgacggcctgcgcgccgaacgcgagcagggcatcaccatcgacgtggcg
taccgctacttcgcgaccgcgcgccgccggttcatcctcgccgacacccccggccatgtt
cagtacacccgcaacatggtcaccggcgcctccaccgccgacctggccgtcatcctggtg
gacgcccgcaacggcgtcatcgagcagacccgccggcacgccgccgtcgccgcgctgctg
cgcgtcccgcacatcgtgctcgcggtgaacaagatggatctcgtcgggtacgaggagaag
gagttcgaccggatcgtcgaggacttcgcgggccacgcggcggagctggacctgcccggc
ttcactcccgtcccggtgtccgcgctgtgcggcgacaacgtggtcgagcgctcggcgcac
atggactggtacgcgggcccggcgctcctcgacctcctggagacggtcccggtcggcgcc
gagtcggccggcgccccggcccgcttcccggtgcagtacgtgatccggcacgacggggtc
cgccactacgcgggccagttggtgtcgggctcactgcgggtcggcgaccgggtgaccgtc
cacccgtccggcgagacctccgagatcaccggcatcgacgtgctcggcacaacggcgcgg
gcggcgtacgcgccgcagtcgctgaccctgcgcctggccggacagcgggacatagcgcgg
ggcgacatgatcaccgccggccccgacgctcccgagctcacgcgggacgtccgggcggcc
gtctgccatctggccgaccgcccgctgcgcatcggcgaccgggtgctggtcaagcacacg
acgcggacggtgaaggcactggtcaaggacctggccggcgcgaccgagctgaccgcgaac
gacctcggcaggatcgccctccgcacggccgagcccctggccctggacgactacgcccgg
gtgcgccgcacgggcgccttcctgctggtcgacccggcggacggcgcgaccctgaccgcc
gggatggcagacctgtcgtag

DBGET integrated database retrieval system