KEGG   Streptomyces avermitilis: SAVERM_2149
Entry
SAVERM_2149       CDS       T00126                                 
Name
(GenBank) putative copper amine oxidase, secreted
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00350  Tyrosine metabolism
sma00360  Phenylalanine metabolism
sma00410  beta-Alanine metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_2149
   00350 Tyrosine metabolism
    SAVERM_2149
   00360 Phenylalanine metabolism
    SAVERM_2149
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_2149
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     SAVERM_2149
SSDB
Motif
Pfam: Cu_amine_oxid
Other DBs
NCBI-ProteinID: BAC69860
NITE: SAV2149
UniProt: Q82L63
Position
complement(2616079..2617398)
AA seq 439 aa
MRVNRISRARRRAAVSLSVAALAVGATTVAGPAVAQTKSAPAAAADCSAAYRIEQKLASG
TTWQMCWHYESEAGLVLENISYQPPGETRPIKVLTSAKLGQIHVPYDDGKAEYSDLTGAG
FGQGLMNMAPGECPGGTIKTVKVPGAWDPQHPNVKGLCTTTRSRGHAYRMQGDTANKVFQ
AQGKDLLVYTVNQVGWYEYITEWRFQDDGTINMNVGATGSLSPVDYDAGDGRGWPLGKGA
KAYATSHSHNIFWRLNFGLDGSSKNTVEQYDSVVTAPARGNEGPTNKTTRTKITKELAGD
AKNMRWWRVVSATGKNKDDHARSYEIVPGATTKYPGRSFTKHDIYFTEYKKCEQFASDNL
RNCGTGAGKSVDKWVGGQTLTHPIAWVNVGFHHIARDEDQQPMPVHWQGFSIAPRDVTAM
NPLTPAELADQNGHVENGS
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcgcgtgaacagaatcagccgggcccgccgccgggcggcggtgtccctgtccgtggcg
gcgctcgccgtcggtgcgacgacggtcgcgggaccggccgtcgcccagaccaagtcggca
cccgcggcggccgccgactgcagcgcggcgtaccggatcgagcagaagctcgcctccggc
accacctggcagatgtgctggcactacgagagcgaggccgggctcgtcctggagaacatc
tcgtaccagccgcccggtgagacacggccgatcaaggtcctcaccagcgccaagctcggc
cagatccacgtcccctacgacgacggcaaagccgagtacagcgacctcacgggtgcgggc
ttcggccagggcctgatgaacatggcgcccggcgagtgccccggcggcaccatcaagacc
gtcaaggtcccgggcgcctgggatccgcagcacccgaacgtcaagggtctgtgcaccacc
acccgttcgcgcggccacgcctaccgcatgcagggcgacacggcgaacaaggtcttccag
gcccagggcaaggacctgctggtctacaccgtgaaccaggtcggctggtacgagtacatc
accgagtggcgcttccaggacgacggcacgatcaacatgaacgtcggcgccaccggcagc
ctctcgcccgtcgactacgacgccggcgacggccgcggctggcccctcggcaagggcgcc
aaggcgtacgcgaccagccacagccacaacatcttctggcggctcaacttcggtctggac
ggctcctcgaagaacacggtcgagcagtacgactccgtggtcaccgcgcccgcccggggc
aacgagggcccgaccaacaagaccacccgcacgaagatcaccaaggaactcgcgggcgac
gccaagaacatgcgctggtggcgggtcgtcagcgcgaccggcaagaacaaggacgaccac
gcgcgttcctacgagatcgtcccgggcgccaccaccaagtaccccggccgcagcttcacc
aagcacgacatctacttcaccgagtacaagaagtgtgaacagttcgccagcgacaacctg
cgcaactgcggtaccggagccggtaagtccgtcgacaagtgggtcggcggacagaccctc
acccacccgatcgcctgggtcaacgtcggtttccaccacatcgcccgggacgaggaccag
cagccgatgccggtacactggcagggcttctcgatagctccgcgcgatgtcaccgctatg
aatccgctcactccggccgagctggccgaccagaacgggcatgtggaaaacggtagttga

DBGET integrated database retrieval system