KEGG   Streptomyces avermitilis: SAVERM_2258
Entry
SAVERM_2258       CDS       T00126                                 

Symbol
acnA
Name
(GenBank) putative aconitase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00630  Glyoxylate and dicarboxylate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sma_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_2258 (acnA)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2258 (acnA)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     SAVERM_2258 (acnA)
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-ProteinID: BAC69969
NITE: SAV2258
UniProt: Q82KV4
Position
complement(2753293..2756010)
AA seq 905 aa
MSANSFDARSTLQVGDESYEIFRLDKVEGSARLPYSLKVLLENLLRTEDGANITADHIRS
IGNWDSQAQPSQEIQFTPARVIMQDFTGVPCVVDLATMREAVKELGGDPAKINPLAPAEL
VIDHSVIADKFGTNDAFAQNVELEYGRNKERYQFLRWGQTAFDEFKVVPPGTGIVHQVNI
EHLARTVMVRGGQAYPDTLVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPRV
VGFKLTGELKPGTTATDLVLTITEMLRKHGVVGKFVEFYGEGVAATSLANRATIGNMSPE
FGSTAAIFPIDDETLKYLRLTGRDEQQVALVEAYAKEQGLWLDPAAEPDFSEKLELDLST
VVPSIAGPKRPQDRIVLANAAQQFAQDVRNYVDEVDEAGKESFPASDAPALRPNGAPSRP
TLVTAPDGSTYEIDHGAVTVAAITSCTNTSNPYVMVAAALVAKKAVEKGLTRKPWVKTTL
APGSKVVTDYFDKAGLTPYLDKVGFNLVGYGCTTCIGNSGPLPEEVSKAVNEHDLAVTSV
LSGNRNFEGRINPDVKMNYLASPPLVVAYALAGSMKVDITKDALGIDQDGKPVYLADIWP
SEAEVNDVVANAIGEDMFNKSYQDVFAGDAQWQALPIPTGNTFEWDPQSTYVRKPPYFEG
MAHEPSPVTDITGARVLAKLGDSVTTDHISPAGAIKADTPAGKYLTEHGVERRDFNSYGS
RRGNHEVMIRGTFANIRLRNQIAPGTEGGYTRDFTQPGAPVSFIYDASRNYIEQGTPLAI
LAGKEYGSGSSRDWAAKGTALLGVKAVIAESYERIHRSNLIGMGVLPLQFPEGANAESLG
LTGEETFSFTGVEELNNGTTPRTVKVTTDTGVEFDAVVRIDTPGEADYYRNGGIMQYVLR
SLIRK
NT seq 2718 nt   +upstreamnt  +downstreamnt
gtgtcggcgaacagcttcgacgcccgcagcacgctgcaggtgggcgacgagtcgtacgag
atcttccggctggacaaggtggaaggctcggctcgccttccgtacagcctgaaggtgctg
ctggagaacctgctccgcaccgaggacggcgcgaacatcaccgccgaccacatccggtcc
atcggcaactgggactcccaggcgcagcccagccaggagatccagttcacgcccgcccgc
gtgatcatgcaggacttcaccggcgtgccctgcgtcgtggacctcgccaccatgcgtgag
gccgtgaaggagctcggcggcgaccccgcgaagatcaacccgctggcgccggccgagctg
gtcatcgaccactccgtcatcgccgacaagttcggcacgaacgacgccttcgcgcagaac
gtcgagctggagtacggccgcaacaaggagcgctaccagttcctgcgctggggccagacc
gccttcgacgagttcaaggtcgtcccgccgggcaccggcatcgtccaccaggtcaacatc
gagcacctcgctcgcacggtcatggtccgaggcggccaggcctacccggacaccctggtc
ggcaccgactcccacaccaccatggtcaacggcctcggtgtgctgggctggggcgtcggt
ggcatcgaggccgaggccgcgatgctcggccagccggtctcgatgctcatcccgcgcgtc
gtcggcttcaagctcaccggtgagctcaagcccggcacgaccgccacggacctcgtgctc
acgatcaccgagatgctgcgcaagcacggcgtcgtcggcaagttcgtcgagttctacggc
gagggtgtggcggccacgagcctcgccaaccgcgccaccatcggcaacatgtcgccggag
ttcggctccaccgccgcgatcttcccgatcgacgacgagaccctgaagtacctgcgcctg
accggccgtgacgagcagcaggtcgcgctcgtcgaggcgtacgccaaggagcagggcctc
tggctcgacccggccgccgagcccgacttctccgagaagctcgagctcgacctctccacg
gtcgtcccgtcgatcgccggcccgaagcgcccgcaggaccgcatcgtcctcgccaacgcg
gcccagcagttcgcccaggacgtccgcaactacgtggacgaggtggacgaggcgggcaag
gagtccttcccggcctccgacgcccccgcgctccgccccaacggtgcgccgagccgcccg
accctcgtcacggcccccgacggctcgacgtacgagatcgaccacggcgcggtgacggtc
gcggccatcacctcctgcaccaacacctcgaacccgtacgtcatggtcgccgccgcgctc
gtcgcgaagaaggccgtggagaagggcctgacccgcaagccgtgggtcaagaccaccctc
gccccgggctccaaggtcgtcaccgactacttcgacaaggcggggctcaccccctacctc
gacaaggtcggcttcaacctcgtcggctacggctgcaccacctgcatcggtaactccggc
ccgctgccggaggaggtctccaaggccgtcaacgagcacgacctcgcggtcacctcggtc
ctctccggcaaccggaacttcgagggccgcatcaaccccgacgtcaagatgaactacctg
gcctccccgccgctggtcgtcgcctacgcgctcgcgggctccatgaaggtggacatcacc
aaggacgcgctgggcatcgaccaggacggcaagccggtctacctggccgacatctggccc
tccgaggccgaggtcaacgacgtcgtggcgaacgccatcggcgaggacatgttcaacaag
tcctaccaggacgtcttcgcgggcgacgcccagtggcaggcgctgccgatcccgaccggc
aacaccttcgagtgggacccgcagtccacctacgtccgcaagcccccgtacttcgagggc
atggcgcacgagccgtccccggtcaccgacatcaccggtgcccgcgtgctggccaagctg
ggcgactcggtcaccaccgaccacatctccccggccggcgccatcaaggccgacaccccg
gccggcaagtacctcaccgagcacggtgtggagcgtcgtgacttcaactcctacggctcg
cgccgaggcaaccacgaggtcatgatccgcggcacgttcgccaacatccgcctgcgcaac
cagatcgcgccgggcaccgagggcggctacacccgcgacttcacccagccgggcgcgccg
gtgtcgttcatctacgacgcctcgcgcaactacatcgagcagggcaccccgctggccatc
ctggccggcaaggagtacggctccggctcgtcccgcgactgggccgccaagggcaccgcg
ctcctcggcgtcaaggccgtcatcgccgagtcgtacgagcgcatccaccgctcgaacctc
atcggcatgggcgtcctgccgctccagttcccggagggcgcgaacgccgagtccctcggc
ctcaccggcgaggagaccttctccttcaccggcgtcgaggagctcaacaacggcaccacc
ccgcgcacggtgaaggtcaccaccgacacgggcgtcgagttcgacgcggtcgtccgcatc
gacacccccggtgaggccgactactaccgcaacggcggcatcatgcagtacgtgctgcgc
agcctgatccgcaagtaa

DBGET integrated database retrieval system