KEGG   Streptomyces avermitilis: SAVERM_2406
Entry
SAVERM_2406       CDS       T00126                                 
Symbol
suhB1
Name
(GenBank) putative myo-inositol 1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
sma  Streptomyces avermitilis
Pathway
sma00521  Streptomycin biosynthesis
sma00562  Inositol phosphate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SAVERM_2406 (suhB1)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAVERM_2406 (suhB1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     SAVERM_2406 (suhB1)
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-ProteinID: BAC70117
NITE: SAV2406
UniProt: Q82KJ7
Position
complement(2932782..2933600)
AA seq 272 aa
MTDQSEHLDHLKAELLEIALDAAARAGAFLRDGRPDDLGVAATKSSAVDVVTEMDIASEK
LITGLLADRRPDDGVLGEEGADVEGTSGVQWVIDPIDGTVNYLYGLPSWAVSIAARKDGE
TLVGVVHAPMRGETYSAVLGQGAFVNDLPARVRPAPAFGLALVGTGFGYLAERRARQAEV
VRQLVPEVRDIRRGGSAAIDLCDVAAGRLDAYYERGLNPWDYAAGDLIAREAGALTGGRP
GEPLSTDLTIAAPPGLFEALQTRLEDLGAWHD
NT seq 819 nt   +upstreamnt  +downstreamnt
gtgaccgaccagtccgagcacctggaccacctcaaggccgaactcctggagatcgcgctc
gacgccgcggcccgcgcgggagccttcctgcgcgacggccgccccgacgacctcggggtg
gccgcgaccaagtccagcgccgtcgacgtcgtcaccgagatggacatcgcctccgagaag
ctgatcaccggcctgctggccgaccgcaggcccgacgacggcgtgctcggcgaggagggc
gccgacgtcgaggggacgagcggtgtccagtgggtcatcgaccccatcgacggaaccgtc
aactatctgtacggcctgcccagctgggccgtctccatcgccgcgcgcaaggacggcgag
acgctcgtcggcgtggtgcacgcgccgatgcgcggcgagacctacagcgccgtcctgggg
cagggcgctttcgtcaacgacctccccgcgcgcgtgcggcccgcgcccgccttcggactg
gccctcgtcggtacgggcttcggctatctcgccgagcgccgggcccggcaggccgaggtc
gtccggcagctcgtccccgaggtccgggacatccgccgcggcggctcggccgcgatcgac
ctgtgcgacgtggcggccggccgcctggacgcgtactacgagcgcggactgaacccctgg
gactacgcggcgggcgacctcatcgcgcgggaagcgggcgcgctgaccggtggacgcccc
ggagagcccctctcgaccgacctgacgatcgccgccccgcccggcctcttcgaggcgctc
cagacccgcctggaggacctcggggcctggcacgactga

KEGG   Streptomyces avermitilis: SAVERM_372
Entry
SAVERM_372        CDS       T00126                                 
Symbol
suhB2
Name
(GenBank) putative myo-inositol 1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
sma  Streptomyces avermitilis
Pathway
sma00521  Streptomycin biosynthesis
sma00562  Inositol phosphate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SAVERM_372 (suhB2)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAVERM_372 (suhB2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     SAVERM_372 (suhB2)
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-ProteinID: BAC68081
NITE: SAV0372
UniProt: Q82QX3
Position
complement(440608..441426)
AA seq 272 aa
MSETLQTTAVAASDADLLAQTANAVRAAGSALRERFGEVVRYQSREELMRALAANDDTAL
DILRPRLTSLRPDAGWVEDELDGGALPPGEWWVVDPAEGNVNHLHALPEWAVTATLVREN
QPVLTAVHLPLTGETYTALTGAGAHVDGRPLHVSPAADLGLSIVATSQARPDEDEKVVRR
VGSSITAMLFDALVVRTAVPATLHLVNVAAGRIDAFWQFAGARADLLPGALLVTEAGGQI
SDAQGRPWTPQSESFLAAAPGIHAEAVATLSH
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtccgaaacgcttcagaccaccgcagtcgccgcctccgacgccgacctgctcgcccag
accgcgaacgccgtgcgtgcggccggttcggcgctgcgcgagcgcttcggcgaggtggtc
cgttaccagagccgtgaagagctgatgcgcgcgctggccgccaacgacgacacggccctc
gacatcctgcgtccccgcctcacgagcctgcgcccggacgccggctgggtggaggacgag
ctggacggcggggcgctgccgcccggcgaatggtgggtcgtggatccggccgaaggcaac
gtcaaccacctgcacgccctgccggaatgggcggtgaccgccaccctcgtgcgtgagaac
cagccggtgctcaccgcggtccacctgccgttgaccggcgagacctacaccgcgctcacc
ggcgcgggcgcccacgtcgacggccggccgctgcacgtctccccggccgcagacctcggc
ctgagcatcgtggccaccagccaggcccggccggacgaggacgagaaggtcgtgcggcgc
gtcggctcttcgatcaccgcgatgctcttcgacgcgcttgtcgtccgcaccgccgtgccc
gcgaccttgcacctggtgaacgtggccgccggccggatcgacgccttctggcagttcgcc
ggcgcccgcgcggacctgctgcccggagcgctcctcgtcaccgaggccggcggacagatc
tccgacgcccagggccgcccctggaccccgcagagcgagagcttcctggccgccgcgccc
ggcatccacgccgaggccgtcgccaccctttcccactga

DBGET integrated database retrieval system