KEGG   Streptomyces avermitilis: SAVERM_2427
Entry
SAVERM_2427       CDS       T00126                                 

Symbol
citA3
Name
(GenBank) putative citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00630  Glyoxylate and dicarboxylate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sma_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_2427 (citA3)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2427 (citA3)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SAVERM_2427 (citA3)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: BAC70138
NITE: SAV2427
UniProt: Q82KH6
Position
complement(2957989..2959155)
AA seq 388 aa
MPINRAASTSVDVPRGLAGVVVTDTSLGDVRGLEGFYHYRQYSAVELAQTRGFEDVWHLM
VHGELPDAEQRAVFTARTAALRWLPDGVRATLPAVAAAAGRSGPLAGLRTALSLLGAAKG
FRPVYDIDREQRRADTVMASAAVPTLLTALYRLGQGLDPVEPREDLSYAANYLYMLTGSE
PDAARTRAIEQYLISTIDHGFNASTFTARVITSTGADVAAALVGAVGALSGPLHGGAPSR
ALDTLDAIGTPERIDSWIRERVLAGDRIMGFGHPVYRTEDPRSRMLRGVAEQFGGPLVDF
AVEVERHVEAILAELKPGRELHTNVEFYAGVVMELCGLPREMFTPTFAAARVVGWSANIL
EQAEDPKIIRPAARYVGPVPPVAVPLMV
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgccgatcaaccgggccgcatccacttctgtcgacgtcccacggggccttgccggcgtt
gtcgtcaccgacacctcattgggtgatgtcagagggctggaaggcttctaccactaccgc
cagtactcggccgtcgaactcgcgcagacccgcggtttcgaggacgtctggcatctgatg
gttcatggcgaactgccggacgcggagcagcgggccgtcttcaccgcgcggaccgcggcg
ctgcggtggctgccggatggggtgagggccacgctgccggccgtggccgccgccgcgggc
cgctccggaccgctcgccgggctgcgcacggcgctgtccctgctcggtgccgccaagggg
ttccggccggtgtacgacatcgaccgggaacagcgccgcgccgacaccgtcatggcatcg
gccgccgtgcccacactcctgacggcgctgtaccgactcgggcaggggctggatcccgtg
gagcctcgcgaggacctctcctatgcggcgaactacctctacatgttgacgggctcggag
ccggacgcggccaggaccagggcgatcgagcagtacttgatctcaaccattgaccacgga
ttcaatgcatcaaccttcacagcccgagtgatcacatcgacgggtgcggatgtggcggcg
gccctggtgggcgcggtgggagcgctgtccgggccgctccatggaggggcgcccagccgg
gccctcgacaccctggacgcgatcggtacgcccgagcgcatcgactcctggatacgcgag
cgcgtcctggccggcgaccgcatcatgggcttcgggcaccccgtctaccgcacggaggac
ccccgctcccgcatgctccgcggcgtcgcggagcagttcggtggcccgctggtggacttc
gcggtcgaggtcgaacgccatgtggaggcgatcctcgcggaactgaagccgggccgtgaa
ctccacacgaacgtggagttctacgcgggcgtggtcatggaactctgcggcctgccacgg
gagatgttcactcccacgttcgcggcggcccgggtggtcggctggagcgccaacatcctg
gaacaggcggaggacccgaagatcatccgaccggcggcccggtatgtggggccggtaccg
ccggtggcggtgccactgatggtttga

KEGG   Streptomyces avermitilis: SAVERM_2428
Entry
SAVERM_2428       CDS       T00126                                 

Name
(GenBank) putative citrate synthase-like protein
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00630  Glyoxylate and dicarboxylate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sma_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_2428
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2428
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SAVERM_2428
SSDB
Motif
Pfam: Citrate_synt HTH_17 MerR MerR_1 Sigma70_r4_2 HTH_23 Terminase_5 HTH_29 HTH_Tnp_1
Other DBs
NCBI-ProteinID: BAC70139
NITE: SAV2428
UniProt: Q82KH5
Position
2959252..2960508
AA seq 418 aa
MTDHEAAPTHPDRRLSTKEAAELLGVKPETVYAYVSRGQLSSRREPGGRGSTFDAKEVAA
LARRNRREPSGSSAIGGELSVRTRITLIDKDRYFFRGVDATELAARHSYEEIAEWLWTGR
LRPGVTFAAPDASVAVARRAVDALPEHSGPTDRLRVATIAAATADPLRFDLSEDAVLGTA
RTLIPTLVAALPPLRRDHRDEGPLARHLWGRLTGRAPDAASVRVLDTALGLLIDHDLAAS
TLAVRVAASARAHPYAAVSAGLGVLEGPLHGAASGLAHRLLLDVLDQGSAAPVVADELRA
GRRIPGLGHRLYPGEDPRARALFALLEEVPDAAPALAAAHDVVATTARHAPLHANVDLAL
AVLTVSSGMPASAGETVFAVARTAGWIAHALEEYEERPLRMRPSGRYVGARPPQPLPR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgacggaccacgaagccgcgcccacgcaccccgatcggcgactgagcaccaaagaggcc
gccgaactgctcggcgtgaagcccgagaccgtgtacgcctatgtgagccgcggccagctc
agcagccgccgcgagcccggcgggcgcggcagcaccttcgacgccaaagaggtggcggcg
ctcgcccggcgcaacaggcgtgagccgagcgggagttcggccatcggcggcgagctgtcc
gtccgcacacggatcaccctcatcgacaaggaccggtacttctttcgcggcgtcgacgcg
accgaactcgccgcgcggcactcctacgaggagatcgccgagtggctgtggaccggtcgg
ctgcggcccggagtcacctttgccgctccggacgcgtccgtcgccgtcgcccgccgcgcc
gtcgatgccctgcccgagcacagcggtccgaccgaccggctgcgcgtcgcgacgatcgcc
gccgcgaccgcggacccgctccgcttcgacctgtccgaggacgcggtcctcggcaccgca
cgcaccctcatccccaccctcgtggccgccctcccgcccctgcgccgcgaccaccgcgac
gagggcccgctcgcccggcacctgtggggacggctcaccggccgcgcacccgacgcggca
tcagttcgcgtactggacacggcactcgggctgctcatcgaccacgacctggccgcctcg
acgctcgcggtccgtgtcgccgcctcggccagggcccacccgtacgctgccgtctcggcg
ggtctcggcgtgctcgagggccccctgcacggcgcggccagcggcctcgcgcaccggttg
ctcctggacgtcctggaccagggcagcgcagcccccgtggtcgccgacgaactgcgtgcc
ggtcgccgtatccccggtctcggccaccggctctaccccggcgaggacccgcgcgcgcgt
gctctgttcgccctcctggaagaggtacccgacgcggcccccgcccttgccgctgcccat
gacgtcgtggccaccacggcccgccacgcgcccctgcacgccaacgtggacctggctctc
gcggtcctcacggtctcctccggcatgcccgcctccgccggcgagaccgtcttcgccgtc
gcccgtacggcgggctggatcgcacatgccctggaggagtacgaggagcgtccgctgcgg
atgcgcccgagtggccgatacgtaggggcgcggcctccgcaaccgctcccccggtag

KEGG   Streptomyces avermitilis: SAVERM_3859
Entry
SAVERM_3859       CDS       T00126                                 

Symbol
citA2
Name
(GenBank) putative citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00630  Glyoxylate and dicarboxylate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sma_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3859 (citA2)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_3859 (citA2)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SAVERM_3859 (citA2)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: BAC71571
NITE: SAV3859
UniProt: Q82GN8
Position
4767277..4768377
AA seq 366 aa
MSDFVPGLEGVIAFETEIAEPDKEGGALRYRGVDIEDLVGHVSFGNVWGLLVDGAFNPGL
PPAEPFPIPVHSGDIRVDVQSALAMLAPVWGLKPLLDIDAEQARHDLARAAVMALSYVAQ
SARGQGLPMVPQSEIDKAHSVVERFMIRWRGEPDPKHVAAVDAYWTSAAEHGMNASTFTA
RVIASTGADVAAALSGAVGAMSGPLHGGAPSRVLGMIEEIERTGDAEAYVKKALDKGERL
MGFGHRVYRAEDPRARVLRRTARELGAPRFEIAEALEKAALEELHNRRPDRVLATNVEFW
AAIMLDFAEVPAHMFTSMFTCARTAGWSAHILEQKRTGRLVRPSARYVGPGSRGPQEIEG
YEDIAR
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgtccgacttcgtacccggactcgaaggagtcatcgcgttcgagacggagatcgccgaa
ccggacaaggagggcggcgcactccggtaccggggcgtcgacatcgaggatctggtcggc
cacgtctccttcggcaacgtctgggggctgctcgtcgacggcgccttcaaccccggcctg
ccgcccgccgaaccgttccccatccccgtgcactccggcgacatccgtgtcgacgtccag
tccgcgctcgccatgctcgcccccgtctggggcctgaaaccgctgctcgacatcgacgcc
gagcaggcccgccacgacctcgcccgcgccgccgtcatggccctgtcctacgtcgcccag
tccgcccgcggccagggcctgcccatggtcccgcagagcgagatcgacaaggcgcactcc
gtcgtcgaacggttcatgatccgctggcggggcgagccggaccccaagcacgtggcggcc
gtcgacgcgtactggacgtcggccgccgagcacggcatgaacgcctccaccttcaccgcg
cgtgtgatcgcctcgacgggcgcggacgtcgccgccgccctctccggggccgtcggcgcc
atgtccggaccgctgcacggcggtgcgccctcccgggtcctcggcatgatcgaggagatc
gaacggacgggagacgccgaggcgtatgtgaagaaggctctggacaagggcgaacgcctc
atgggtttcggccaccgcgtctaccgcgccgaggacccgcgtgcgcgggtgctccgccgc
accgcccgcgagctgggcgccccgcgcttcgagatcgccgaggcgctggagaaggcggcc
ctggaggagctccacaaccgccgccccgaccgcgtcctcgccaccaacgtggagttctgg
gcggcgatcatgctcgacttcgccgaggtgccggcgcacatgttcacctcgatgttcacc
tgcgcccgcacggccggctggtcggcgcacatcctggagcagaagcgcacgggccggctc
gtacgcccgtccgcacgctatgtgggccccggttcgcgcggcccccaggagatcgagggc
tacgaggacatcgcgcgctga

KEGG   Streptomyces avermitilis: SAVERM_5330
Entry
SAVERM_5330       CDS       T00126                                 

Symbol
citA1
Name
(GenBank) putative citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00630  Glyoxylate and dicarboxylate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sma_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_5330 (citA1)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_5330 (citA1)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SAVERM_5330 (citA1)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: BAC73042
NITE: SAV5330
UniProt: Q82CL5
Position
6458679..6459968
AA seq 429 aa
MSDNSVVLRYGDGEYTYPVIDSTVGDKGFDIGKLRAQTGLVTLDSGYGNTAAYKSAITYL
DGEQGILRYRGYPIEQLAERSTFLEVAYLLINGELPTVDELSTFKGEITQHTLLHEDVKN
FYRGFPRDAHPMAMLSSVVSALSTFYQDSHNPFDEKQRNLSTIRLLAKLPTIAAYAYKKS
IGHPFVYPRNDLGYVENFLRMTFSVPAQDYDLDPVVVSALDKLLILHADHEQNCSTSTVR
LVGSSQANMFASISAGISALWGPLHGGANQSVLEMLEGIQTSGGDVDTFIRKVKNKEDGV
KLMGFGHRVYKNFDPRAKIIKAAAHDVLSALGKSDELLDIALKLEEHALADDYFVERKLY
PNVDFYTGLIYRAMGFPTEMFTVLFALGRLPGWIAQWHEMIKEPGSRIGRPRQIYTGEVL
RDFVPVEGR
NT seq 1290 nt   +upstreamnt  +downstreamnt
gtgagcgacaactctgtagtactgcggtacggcgatggcgagtacacctacccggtgatc
gacagcaccgtcggcgacaagggcttcgacatcgggaagctccgcgctcagaccggtctg
gtgactctggacagtgggtacggcaacactgccgcctataaatccgcgatcacctatctc
gacggtgagcagggcatcctccggtaccgcggctacccgatcgagcagctggccgagcgc
tccaccttcctggaggtggcgtacctgctgatcaacggcgagctgccgaccgtcgacgag
ctctccacgttcaagggcgagatcacgcagcacaccctgctgcacgaggacgtcaagaac
ttctaccgcggcttcccgcgtgacgcccacccgatggcgatgctgtcctcggtggtctcc
gcgctgtcgacgttctaccaggacagccacaacccgttcgacgagaagcagcgcaatctc
tccacgatccgccttctcgccaagcttccgacgatcgcggcgtacgcctacaagaagtcg
atcggtcaccccttcgtctacccgcgcaacgacctcgggtacgtcgagaacttcctgcgc
atgaccttctcggtcccggcgcaggactacgacctggacccggtcgtcgtctccgcgctc
gacaagctgctgattctgcacgcggaccacgagcagaactgttcgacctccaccgtgcgt
ctggtcggctcgtcgcaggcgaacatgttcgcgtcgatctccgccggcatctccgccctc
tggggcccgctgcacggtggcgccaaccagtccgtcctggagatgctcgagggcatccag
acgagcggtggcgacgtcgacaccttcatccgcaaggtgaagaacaaggaagacggcgtg
aagctcatgggcttcgggcaccgcgtctacaagaacttcgacccccgcgcgaagatcatc
aaggcggcggcgcacgacgtcctctcggcgctcggcaagtccgacgagctgctggacatc
gcgctgaagctggaggagcacgcgctggccgacgactacttcgtcgagcgcaagctctac
ccgaacgtggacttctacaccggtctgatctaccgcgccatgggcttcccgaccgagatg
ttcacggtcctgttcgccctcggccgccttccgggctggatcgcccagtggcacgagatg
atcaaggagccgggctcccgcatcggccgcccgcgccagatctacacgggcgaggtcctg
cgcgacttcgtcccggtcgagggccggtaa

DBGET integrated database retrieval system