KEGG   Streptomyces avermitilis: SAVERM_2515
Entry
SAVERM_2515       CDS       T00126                                 
Name
(GenBank) putative hydrolase of the metallo-beta-lactamase superfamily
  KO
K12574  ribonuclease J [EC:3.1.-.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_2515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_2515
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     SAVERM_2515
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     SAVERM_2515
SSDB
Motif
Pfam: RNase_J_C Lactamase_B RMMBL Lactamase_B_2 DUF1732
Other DBs
NCBI-ProteinID: BAC70226
NITE: SAV2515
UniProt: Q82K88
Position
complement(3079351..3081036)
AA seq 561 aa
MSHPHPELGPPPKLPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGI
DLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQ
EHRIRPYTLEVAEGNRERIGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLP
LDNRLTDLHAFARLSEEGIDLLLSDSTNAEVPGFVPPERDISNVLRNVFAGARKRIIVAS
FASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPE
HEIVLVCTGSQGEPMAALSRMANRDHQIRIVQGDTVILASSLIPGNENAVYRVINGLTRW
GAHVVHKGNAKVHVSGHASAGELLYFYNICKPRNLMPVHGEWRHLRANAELGALTGVPHD
RIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLSVGDVGEPALKDRKILGDEGIISVFL
VVDASTGKITGGPHIQARGSGIDDSAFGDVIPKIAEVLERSAQDGVMEPHQLQQLIRRTL
GKWVSDTYRRRPMILPVVVEV
NT seq 1686 nt   +upstreamnt  +downstreamnt
ttgagtcatccgcatcctgaactcggcccgccgccgaagctccccaagggcggccttcgg
gtcaccccgctgggcggtctcggcgaaatcggccgcaacatgaccgtcttcgagtacggc
ggtcgcctgctgatcgtcgactgcggagtgctcttccccgaggaggagcagcccggaatc
gacctgatcctgccggacttcacgtccatcagggaccgcctcgacgacatcgagggcatc
gtcctcacccatggccacgaggaccacatcggcggcgtcccgttcctcctccgggagaag
ccggacatcccgctgatcggctccaagctgaccctcgcactcatcgaggcgaagctccag
gagcaccgcatccgtccgtacacccttgaggtggcggaggggaaccgcgagcgcatcggc
ccgttcgactgcgagttcgtcgccgtcaaccactccattccggacgccttggcggtcgcc
atccgcactccggccggcatggtcgtccacacgggcgacttcaagatggaccagctcccg
ctggacaaccgtctgacggacctccacgcgttcgcgcggctgagtgaggagggcatcgac
ctcctcctctcggactcgacgaacgcggaggtcccgggtttcgtcccgcccgagcgcgac
atctcgaacgtgctgcgcaacgtcttcgcgggcgcccgcaagcggatcatcgtggcgagc
ttcgccagccacgtccaccgcatccagcagatcctggacgcggcgcacgagtacggccgc
cgggtcgccttcgtcggacgctcgatggtccgcaacatgggcatcgcccgggacctgggc
tatctgaaggttccgccgggcctggtcgtggacgtcaagacgctggacgacctcccggag
cacgagatcgtgctggtctgcacgggctcgcagggcgagccgatggcggctctgtcacgc
atggccaaccgggaccatcagatccgcatcgtccagggcgacacggtcatcctcgcgtcg
tcgctcatccccggtaacgagaacgcggtctaccgcgtgatcaacggcctgacccgctgg
ggcgcgcacgtcgtccacaagggcaacgccaaggtgcacgtctcgggccacgcctcggcc
ggcgagctgttgtacttctacaacatctgcaagccacgcaacctcatgccggtccacggc
gaatggcgccatctgcgggccaacgccgagctgggcgctctcaccggcgtcccgcacgac
cgcatcgtgatcgccgaggacggcgtcgtcgtcgacctggtcgagggcaaggccaagatc
accggcaaggtccaggcgggatacgtgtacgtcgacggcctctcggtcggcgacgtcggc
gagcccgcgctcaaggaccgcaagatcctcggcgacgaggggatcatctcggtcttcctg
gtcgtggacgcgtccaccggaaagatcactggtggtccccacatccaggcccgtggctcc
ggcatcgacgactccgcgttcggcgacgtcatcccgaagatcgccgaagtgctggagagg
tccgctcaggacggggtcatggagccccaccagctgcagcaactcatccgccgcacactg
ggcaagtgggtctcggacacctaccggcgccggccgatgatcctgccggtcgtggtcgag
gtctga

DBGET integrated database retrieval system