KEGG   Streptomyces avermitilis: SAVERM_2636
Entry
SAVERM_2636       CDS       T00126                                 
Symbol
lepB1
Name
(GenBank) putative signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
sma  Streptomyces avermitilis
Pathway
sma03060  Protein export
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_2636 (lepB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_2636 (lepB1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     SAVERM_2636 (lepB1)
Peptidases and inhibitors [BR:sma01002]
 Serine peptidases
  Family S26: signal peptidase I family
   SAVERM_2636 (lepB1)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24
Other DBs
NCBI-ProteinID: BAC70347
NITE: SAV2636
UniProt: Q82JW8
Position
complement(3234534..3235277)
AA seq 247 aa
MSRTGRTDEGHGRLGSTLSGLAVALGCVLFLGGFAWGAVVYRPYTVPTPSMSPTIVAGDR
VLAQRVDGGDIKRGDVVVFKQKSWGDMLMVKRVVAVGGDTVGCCTGGKLTVNGKQIQEPY
LPKGQAAEVRTIPTVTVPKDRLFLLGDERSGSLDSTAHLTEAFDGTVARSGVKARVDAVV
WPMNGMLERPTGFEALGSLSSPGPLRLVVAAIVGGAVLVLGGAAYGPIANRARRRRSGAR
MEPAGAR
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagcaggaccggtcgtacggacgagggccacggacggctcggcagcacgctgtcggga
ctggccgtggccctcggctgtgtgctcttcctcggcgggttcgcctggggagcggtcgtc
taccggccgtacacggtgccgaccccatcgatgtcgcccaccatcgtggccggcgaccgg
gtccttgcccagcgggtcgacggaggcgacatcaagcgtggtgacgtcgtcgtcttcaag
cagaagagctggggcgacatgctcatggtcaagcgggtcgtggctgtcggcggcgacacg
gtcggctgctgcaccggcggcaagctgaccgtcaacggcaagcagatccaggagccgtat
ctgcccaagggccaggccgcggaggtccggacgatccccacggtcacggtccccaaggac
cggctgttcctgctcggcgacgagcgcagcggctccctggactccacggcccacctcacc
gaggccttcgacggcacggtggcgcgcagcggggtgaaggcccgggtggacgccgtggtg
tggcccatgaacggcatgctggagcgccctacgggcttcgaggccctgggaagcctgtcc
tctcccggcccgctgcggctggtcgtcgccgcgatcgtcgggggggcggtgctggtcctg
ggcggtgcggcgtacggcccgatcgcgaatcgggcgcgccgcaggcgcagcggggcgcgg
atggagcccgccggtgcccgctga

KEGG   Streptomyces avermitilis: SAVERM_2637
Entry
SAVERM_2637       CDS       T00126                                 
Symbol
lepB2
Name
(GenBank) putative signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
sma  Streptomyces avermitilis
Pathway
sma03060  Protein export
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_2637 (lepB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_2637 (lepB2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     SAVERM_2637 (lepB2)
Peptidases and inhibitors [BR:sma01002]
 Serine peptidases
  Family S26: signal peptidase I family
   SAVERM_2637 (lepB2)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24 DUF5345
Other DBs
NCBI-ProteinID: BAC70348
NITE: SAV2637
UniProt: Q82JW7
Position
complement(3235357..3236232)
AA seq 291 aa
MEDAATSASDSGDGDGGGTRESGEQGGQPKKQRSFWKELPLLIGIALILALLIKTFLVQA
FSIPSDSMQNTLQQGDRVLVDKLTPWFGSEPERGEVVVFHDPANWLAGEPTATPNPLQRV
LGWIGLMPSSNEKDLIKRVIGVAGDTVECKGTGPLKVNGHALNDTFVYAGNTPCSVDDQG
GQFKVKVPKGKIWVMGDHRQNSLDSRYHQQDKNHGFVPVDNVIGRAIVIAWPPTRWNTLP
IPDAFDQNLSAAAPGALGLAGAVPLVLWRRHRLAGGPTGGNPRVSSDGTAG
NT seq 876 nt   +upstreamnt  +downstreamnt
gtggaagacgccgcgacctccgcgagtgactccggagacggagacggcggcggtacccgg
gagagcggcgagcagggcggtcagcccaagaagcagcgctccttctggaaggaactcccg
ctcctcatcggtatcgcgctgatcctggcgctgctgatcaagaccttcctggtacaggcg
ttctcgattccctcggactcgatgcagaacaccctccagcagggcgaccgtgtcctcgtc
gacaagctgaccccctggttcggctcggagcccgagcgcggcgaggtcgtcgtcttccac
gaccccgccaactggctggcgggcgagccgacggccaccccgaaccccctgcagcgggtc
ctcggctggatcggcctgatgccgtcgtcgaacgagaaggacctcatcaagcgggtcatc
ggcgtcgcgggcgacaccgtcgagtgcaagggcaccggccccctgaaggtcaacggtcac
gcgctgaacgacaccttcgtctatgccgggaacaccccgtgcagcgtggacgaccagggc
ggtcagttcaaggtgaaggtacccaagggcaaaatctgggtcatgggtgaccaccggcag
aactccctggactcccgctaccaccagcaggacaagaaccacggcttcgtgcccgtggac
aacgtcatcggccgcgccatcgtgatcgcctggccgcccacccgctggaacacgctgccg
attccggacgccttcgaccagaacctcagcgcggcagcccccggcgccctcgggctcgcg
ggagcggtgccgctggtcctgtggcgcaggcaccgtctcgccggcggtcctaccggcgga
aacccgagggtttctagcgacggtaccgccgggtag

KEGG   Streptomyces avermitilis: SAVERM_2638
Entry
SAVERM_2638       CDS       T00126                                 
Symbol
lepB3
Name
(GenBank) putative signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
sma  Streptomyces avermitilis
Pathway
sma03060  Protein export
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_2638 (lepB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_2638 (lepB3)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     SAVERM_2638 (lepB3)
Peptidases and inhibitors [BR:sma01002]
 Serine peptidases
  Family S26: signal peptidase I family
   SAVERM_2638 (lepB3)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24 DUF5345
Other DBs
NCBI-ProteinID: BAC70349
NITE: SAV2638
UniProt: Q82JW6
Position
complement(3236204..3237286)
AA seq 360 aa
MGNRGKPRGVSSSAAENLLPTGARRASGGAVRPGRAERRKLQRKVKRRRRRSAVKEIPLL
VGVAVLIALVLKTFLLQAFVIPSGSMENTIQIGDRVLVDKFTPWFGSKPQRGDVVVFKDP
GNWLAGEKTTKKNDPVVVKQVKEGLVAIGLLPSDNDKDLIKRVVAVGGDTVKCCDAQGRV
TVNGMPLSEPYIHPGNKPSAFDFSVTVPQGRLWVMGDHRANSADSRYHRTEQYGGTVSED
SVVGRAMVIAWPLGHWTRLKEPDTYASVPGGVTTALGPSHRVASADRYGLIPLPSPAELP
LVMGVVGLRRLRRGRRHGVRSGCGGFGGRRTIRTRWPRRSAGAARRDGTPGSGRRRDLRE
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgggtaaccgaggcaaaccccgcggtgtgtcgagcagcgccgccgagaacctgctgccc
accggagcgcgccgcgcctccggcggtgccgtgcggccgggacgcgccgagcggcgcaag
ctgcaacgcaaggtcaagcggcgcagaaggcgctcggcggtcaaggagatacctctcctc
gtgggtgtcgccgtcctcatagccctggtcctgaagacgttcctcctccaggccttcgtg
atcccctcgggctccatggagaacacgatccagatcggcgaccgggtcctcgtcgacaag
ttcacgccgtggttcggctccaagccgcagcgcggtgacgtggtcgtcttcaaggacccc
gggaactggctcgcgggcgagaagaccaccaagaagaacgaccccgtcgtcgtcaagcag
gtcaaggagggtctcgtcgccatcggcctgctgccctccgacaacgacaaggacctcatc
aagcgggtcgtcgccgtcggcggtgacaccgtcaagtgctgtgacgcccaagggcgcgtg
accgtcaacggcatgccgctcagcgagccgtacattcacccgggaaacaaaccttcggcg
ttcgacttctcggtgaccgtgccgcaggggcgtctgtgggtcatgggcgaccaccgggcc
aactcggccgactcccgctaccaccgcaccgagcagtacggcggtactgtctccgaggac
tccgtcgtgggccgcgccatggtcatcgcctggcccctgggccactggacgcgcctgaag
gaaccggatacgtacgcgtccgtgccgggcggcgtgaccaccgctctcggcccgtcgcat
agggtggcctccgcggatcgatatggattgatccccctcccgagccctgcggaactcccg
ctcgttatgggagtggtgggcctgcgccgactacggcgcgggcggcggcacggagtgagg
agtggatgtgggggatttggcggtcggcgcacgatccggacacgatggccccgaagatcg
gccggagcggcacgacgggacggtacccccggcagtggaagacgccgcgacctccgcgag
tga

KEGG   Streptomyces avermitilis: SAVERM_2639
Entry
SAVERM_2639       CDS       T00126                                 
Symbol
lepB4
Name
(GenBank) putative signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
sma  Streptomyces avermitilis
Pathway
sma03060  Protein export
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_2639 (lepB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_2639 (lepB4)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     SAVERM_2639 (lepB4)
Peptidases and inhibitors [BR:sma01002]
 Serine peptidases
  Family S26: signal peptidase I family
   SAVERM_2639 (lepB4)
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: BAC70350
NITE: SAV2639
UniProt: Q82JW5
Position
complement(3237279..3237995)
AA seq 238 aa
MDTEAQHTERDRSSSPFESEEISDTQGPEGRSRFALVSRVADWLPGGRITLTLLSCLLFL
LALSNFVMQPFQIPSSSMEGALRIGDRVLVNKLAYRFGSKPQRGDVVVFDGTGYFGDADY
VKRVVGVGGDHVVCCDREGRLKVNGRPVDESSFLYPGDSPSDVDFDVVVPDGTLFVLGDH
RSDSRDSRDHLGSPGGGMIPVGEVVGRADWIVWPAGHGTHLRRPGAYARVPAVDGAHG
NT seq 717 nt   +upstreamnt  +downstreamnt
atggacaccgaagcacagcacacggagcgcgaccgctcctccagccctttcgaatccgag
gagatctcggacacacaggggccggagggccggtcgcgtttcgcgttggtgtcccgggtc
gccgactggctcccgggcgggcggatcaccctcaccctgctgagctgcctgctgtttctc
ctggcgctcagcaacttcgtgatgcagccgttccagatccccagcagttccatggagggc
gcattgaggattggggaccgcgttctcgtaaataagttggcgtaccgtttcggttcgaag
ccgcagcgcggtgacgtcgtcgtcttcgacggcaccggctatttcggggacgccgactac
gtcaagcgcgttgtcggtgtagggggagaccatgtggtctgctgcgacagggaggggagg
ctcaaggtgaacggccggccggtcgacgagtcgtcgtttctgtatccaggagacagcccg
tccgatgtcgacttcgacgtcgtcgttcccgacggcacgctcttcgtcctcggcgaccac
cgcagcgactcccgcgactcccgcgaccacctgggctctccgggcggcggcatgatcccc
gtcggtgaagtcgtcggccgggccgactggatcgtctggcccgccggccacgggacgcac
cttcgacgccccggcgcctacgcgcgcgtgcccgccgtggacggtgcccatgggtaa

DBGET integrated database retrieval system