KEGG   Streptomyces avermitilis: SAVERM_2654
Entry
SAVERM_2654       CDS       T00126                                 
Symbol
ftsY
Name
(GenBank) putative signal recognition particle receptor
  KO
K03110  fused signal recognition particle receptor
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_2654 (ftsY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_2654 (ftsY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_2654 (ftsY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_2654 (ftsY)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_2654 (ftsY)
SSDB
Motif
Pfam: SRP54 SRP54_N AAA_30 CbiA AAA_16 AAA_22 MMR_HSR1 AAA_24 AAA_17 Zeta_toxin AAA_19 AAA_33 AAA_5 MobB Thymidylate_kin AAA_28 DUF6479 AAA_18 AAA APS_kinase AAA_31 PEPCK_ATP P-loop_TraG
Other DBs
NCBI-ProteinID: BAC70365
NITE: SAV2654
UniProt: Q82JV0
Position
complement(3253315..3254544)
AA seq 409 aa
MADTGRVMETVILAVVIAVVVLGALGGLVIGSRRKKPLPPAPPTTPDITAPPAEPHVGDE
AEQPRDEPRRTIEEVDLPDKSAAAPVAVEEAPVVEVPAIEVPEPTAGRLVRLRTRLSRSQ
NALGKGLLTLLSREHLDEDTWEEIEDTLLTADVGVQPTQELVERLRERVKVLGTRTPQEL
RGLLREELLQLLVPEFDREVRTDSNLDTPGIVMVVGVNGTGKTTTTGKLARVLVADGKHV
VLGAADTFRAAAADQLQTWGERVGARTVRGPEGGDPASIAFDAVKEGIEEGADVVLIDTA
GRLHTKTGLMDELGKVKRVVEKHAPLDEVLLVLDATTGQNGLVQARVFAEVVNITGIVLT
KLDGTAKGGIVIAVQRELGVPVKLIGLGEGADDLAPFEPEAFVDALVGE
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggccgatactggacgcgttatggaaaccgtcatccttgctgtagtcatcgccgtggtc
gtgctcggcgcgctcggtgggctcgtcatcggcagtcgccgcaagaagccgctgcccccg
gcgccccccacgacgcccgacatcaccgcccctccggccgagccgcatgtcggcgacgag
gccgagcagccgcgcgacgaaccgcgcagaacgatcgaggaggttgatctcccggacaag
tcggcggcggcgccggtcgccgtcgaagaggcacccgtcgtcgaagtcccggcgatcgag
gtcccggagccgaccgcgggacgcctggtgcggctgcgcacccggctctcccgctcgcag
aacgcgctcggcaaggggctgctcacgctcctgtcgcgcgagcacctcgacgaggacacc
tgggaggagatcgaggacacgctgctcaccgccgacgtcggcgtgcagcccacccaggag
ctggtcgagcggctgcgcgagcgggtgaaggtgctcggcacccgtacgccccaggagctg
cgcggcctgctgcgcgaagagctgctccagctcctcgtccccgagttcgaccgcgaggtc
aggaccgactccaacctcgacacccccgggatcgtgatggtcgtcggtgtcaacggcacc
ggcaagaccaccaccaccggcaagctcgcccgggtgctcgtcgccgacggcaagcatgtg
gtgctcggcgccgccgacaccttccgtgccgccgccgccgaccagctgcagacctggggt
gagcgcgtcggcgcccgcaccgtgcgcggacccgagggcggcgacccggcgtcgatcgcc
ttcgacgccgtcaaggagggcatcgaggagggcgccgacgtcgtcctcatcgacaccgcg
gggcggctgcacaccaagaccgggctcatggacgagctgggcaaggtcaagcgcgtcgtc
gagaagcacgccccgctcgacgaggtactgctcgtcctcgacgccaccaccgggcagaac
ggcctggtccaggcacgtgtcttcgccgaggtcgtcaatatcaccggcatcgtgctcacc
aagctggacggcaccgccaagggcggcatcgtcatcgccgtgcagcgcgagctgggggtg
ccggtcaaactgatcgggctcggcgagggcgcggacgacctggcgccgttcgagccggag
gcgtttgttgacgctcttgtcggagagtga

DBGET integrated database retrieval system