KEGG   Streptomyces avermitilis: SAVERM_2709
Entry
SAVERM_2709       CDS       T00126                                 
Name
(GenBank) putative glycosyl hydrolase, secreted
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SAVERM_2709
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_2709
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SAVERM_2709
SSDB
Motif
Pfam: Glyco_hydro_30 Ricin_B_lectin RicinB_lectin_2 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2 End_tail_spike
Other DBs
NCBI-ProteinID: BAC70420
NITE: SAV2709
UniProt: Q82JP5
Position
3321963..3323906
AA seq 647 aa
MTRVRGRHLLTPRTPHSPTPEGRRAMRRSTRAARLLLAGLLSTAGLTAVSTAPAHAAGEQ
VTAWLTTTDDTGGRHVVRGLQAQTPFAFQSGSGGSGENITVDENTRYQTFTGGGASFTDT
AAWLMNSSGALSATTRNAAMTKLFSPTDGIGLSFLRNPMGASDLARYGYSYDDVPAGQTD
PNLTSFSIAHDLADVVPLTKQALQLNPSLTVMASPWTAPAWMKDSGSLNGGWLKSEDYGA
YANYFVKYLQAYKAQGVNVSYVTAQNEPTCCSGYPSMSWNASGLAYFTKSELLPKLQAAG
LTTKVLAHDWNWDVYDSYAASTVDDAAVRSHPNFGGIAWHGYGGDIAKQTSVHNQYPTLD
AFGTEHSGGTWIANQQREDMSNIIDYTRNWAKSVTKWSLAVDQNMGPHNGGCGTCTGLVT
VHNGDGASGTVDYTVEYYTMGHLTKFVRPGAQRVASTASASVPNVAWRNPDGSKALIAYN
DASTAKTVTLNWGSQHATYSLPGKTSATFTWSGTQSGGGDQTGSFVGLAGKCLDVASSSS
ANGTAVQLYDCNGSTAQRWTVKADGSVQALGKCLDVTSASTADGAKIQLYDCNGTAAQRW
SYNASTGDVVNTAADKCLDVTGNSSANGARAQIWSCTGAANQKWKLQ
NT seq 1944 nt   +upstreamnt  +downstreamnt
ttgacgcgcgtccgcggccgtcatttactcacgcctcgcacgccccactcccccacccca
gaagggcgacgcgccatgaggagatccactcgggcggcccggcttctgctcgccgggctg
ctcagcaccgccgggctgaccgccgtctcgaccgcgcccgcgcacgccgcgggcgaacag
gtcaccgcctggctgaccacgacggacgacaccggcggacgccatgtcgtgcgcgggctc
caggcccagacgccgttcgccttccagtccggcagcggcggcagcggcgagaacatcacc
gtggacgagaacacccggtaccagacattcaccggtggcggcgcgtccttcacggacacc
gcggcctggctgatgaacagcagcggggcgctgtccgcgacgacccggaacgcggccatg
accaagttgttctcgccgacggacgggatcgggctgtcgttcctgcgcaatccgatgggc
gcctccgacctggcgcggtacgggtactcgtacgacgacgtgccggccgggcagaccgac
cccaacctgacgagcttctccatcgcgcacgacctcgccgacgtggtgccgctcaccaag
caggcgctccagctcaacccctctctgacggtcatggcctcgccatggacggcgccggcc
tggatgaaggacagcggctcgctcaacgggggctggctgaagtcggaggactacggggcg
tacgccaactacttcgtgaagtaccttcaggcgtacaaggcgcagggcgtcaacgtctcg
tacgtgaccgcgcagaacgagccgacgtgctgctcgggttacccgtcgatgagctggaac
gccagcgggctcgcgtacttcaccaagagcgagctgctgccgaagctccaggcggcgggc
ctgacgaccaaggtcctcgcgcacgactggaactgggacgtctacgactcctacgcggcc
tcgacggtcgacgacgcggcggtgcgttcgcaccccaacttcggcgggatcgcctggcac
ggctacggcggtgacatcgccaagcagacgtccgtgcacaaccagtacccgaccctcgac
gccttcggcaccgagcactccggcggcacctggatcgccaaccagcagcgcgaggacatg
tccaacatcatcgactacacccggaactgggcgaagtcggtgaccaagtggtcgctcgcc
gtggaccagaacatgggcccgcacaacggaggttgcggcacctgcacgggtctggtcacc
gtgcacaacggggacggcgcgagcgggaccgtcgactacacggtcgagtactacacgatg
ggtcacctgacgaagttcgtccgcccgggtgcgcagcgcgtcgcgtcgacggcgagtgcg
tcggtgccgaacgtggcgtggcgcaatccggacggttcgaaggcgctgatcgcgtacaac
gacgcgtcgacggcgaagacggtcaccctcaactggggctcgcagcacgcgacgtactcg
ctgcccggcaagacgtcggcgacgttcacctggtcggggacccagtcgggcggcggcgac
cagacgggctcgttcgtggggctcgcgggcaagtgcctggatgtggcgagcagttcgtcc
gcgaacgggacggcggtgcagctgtacgactgcaacggctcgaccgcccagcgctggacg
gtgaaggccgacggttccgtgcaggccctcggcaagtgcctggacgtcacctcggcctcg
acggccgacggcgcgaagatccagctgtacgactgcaacggcacggcggcccagcgatgg
tcgtacaacgcttcgacgggtgatgtggtcaacacggccgccgacaagtgcctcgacgtg
accggcaactcctcggccaacggcgcccgcgcgcagatctggtcctgcacgggcgccgcc
aaccagaagtggaagctccagtga

DBGET integrated database retrieval system