KEGG   Streptomyces avermitilis: SAVERM_2756
Entry
SAVERM_2756       CDS       T00126                                 
Name
(GenBank) putative pyridoxal-phosphate-dependent aminotransferase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma00730  Thiamine metabolism
sma01100  Metabolic pathways
sma01240  Biosynthesis of cofactors
sma04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SAVERM_2756
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAVERM_2756
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sma03016]
    SAVERM_2756
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_2756
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sma02048]
    SAVERM_2756
Enzymes [BR:sma01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SAVERM_2756
Transfer RNA biogenesis [BR:sma03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    SAVERM_2756
 Prokaryotic type
    SAVERM_2756
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SAVERM_2756
Prokaryotic defense system [BR:sma02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   SAVERM_2756
SSDB
Motif
Pfam: Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Pyridoxal_deC STAS_2 Flg_hook
Other DBs
NCBI-ProteinID: BAC70467
NITE: SAV2756
UniProt: Q82JJ9
Position
complement(3384316..3385485)
AA seq 389 aa
MAYLDHAATTPMLPEAVEALTAQLSVTGNASSLHASGRRARRTVEEARETLAEALAARPS
EVVFTSGGTEADNLAVKGLYWSRRDADPVRTRVLASPVEHHAVLDAVHWLGEHEGATVEY
LPVDTYGRVHPEALREAIARNPDDVALATVMWANNEIGTVMPVRELADVAGEFGVPLHAD
AVQAFGQVPVDFGASGLAAMTVSGHKVGGPYGIGALLLGREYSPVPVLHGGGQERHVRSG
TLDVPAIASFAVAGRLAAEQREWFAREIGALRDDLVDAVRGAVPEAILGGDPSGAGRLPA
NAHFTFPGCEGDSLLLLLDAQGIECSTGSACTAGVAQPSHVLLATGTDPDLARGTLRFSL
GHTSTEADVEAVAKAIGPAVERARTAGLS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcttacctcgaccacgccgcgaccacgccgatgctccccgaagcggtcgaggcactg
accgcccagctgagcgtcacgggcaacgcctcctccctgcacgcctccggccgccgcgcg
cggcgcacggtcgaggaggcccgcgaaaccctcgccgaggccctcgccgcccgccccagc
gaggtcgtcttcacctccggcggtaccgaggccgacaacctcgcggtcaagggcctgtac
tggtcccgccgcgacgccgacccggtccgtacccgcgtcctcgccagccccgtcgagcac
cacgccgtcctggacgccgtccactggctcggcgagcacgagggcgccacggtcgagtac
ctccccgtcgacacctacggccgcgtccaccccgaagcgctgcgcgaggccatcgcccgc
aaccccgacgatgtcgccctcgccacggtcatgtgggccaacaacgagatcggcacggtc
atgccggtccgggaactcgccgatgttgccggggagttcggggtcccgctgcacgccgac
gccgtccaggccttcggccaggtcccggtcgacttcggcgcttcgggcctggcggcgatg
accgtctccggccacaaggtcggtggcccgtacggcatcggcgcgctgctgctcggccgc
gagtacagccccgtacccgtgctgcacggcggtggtcaggagcggcatgtgcgctccggc
accctcgacgtgcccgcgatcgcgtccttcgcggtcgcgggacggctcgccgccgagcag
cgcgagtggttcgcccgcgagatcggcgccctgcgcgacgatctggtcgacgccgtgcgg
ggggccgtgcccgaggcgatcctcggcggtgacccgtccggtgcgggccgcctcccggcc
aacgcgcacttcaccttccccggctgcgagggcgactcgctgctcctgctgctggacgcc
cagggcatcgagtgctccacgggctccgcctgcaccgcaggcgtcgcccagcccagccac
gtcctgctggccaccggcaccgacccggacctggcccgcggcaccctgcgcttctccctc
ggccacacctccacggaggcggatgtggaggcggtggcgaaggcgatcggccccgcggtg
gagcgggcacggacggcgggcctgagctga

KEGG   Streptomyces avermitilis: SAVERM_2933
Entry
SAVERM_2933       CDS       T00126                                 
Symbol
dndA
Name
(GenBank) putative DNA modification (L-cysteine desulfurase: pyridoxal phosphate-dependent
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma00730  Thiamine metabolism
sma01100  Metabolic pathways
sma01240  Biosynthesis of cofactors
sma04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SAVERM_2933 (dndA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAVERM_2933 (dndA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sma03016]
    SAVERM_2933 (dndA)
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_2933 (dndA)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sma02048]
    SAVERM_2933 (dndA)
Enzymes [BR:sma01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SAVERM_2933 (dndA)
Transfer RNA biogenesis [BR:sma03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    SAVERM_2933 (dndA)
 Prokaryotic type
    SAVERM_2933 (dndA)
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SAVERM_2933 (dndA)
Prokaryotic defense system [BR:sma02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   SAVERM_2933 (dndA)
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-ProteinID: BAC70644
NITE: SAV2933
UniProt: Q82J49
Position
3677808..3678962
AA seq 384 aa
MSAVVAYLDVAATTRVDPRVAEVVLHWMTEDFGNAGSRTHEYGARAKKAVQQARSYLADT
VGAKTEEVIFTSGATESNNIALLGLAPHGERTGKKHIITSAIEHKAVLEPLLHLAETRGF
TVDVLEPGASGRITVEQVMEHVRPDTLAVSLMHVNNETGVIQPVAELAERLRSTPTYLHV
DAAQGYGKIAGDLTAPIDLISISGHKIGAPKGVGALITRRRGWDKAPLEPIMFGGGQERK
LRPGTLPVPLIMGLHEAARIFHESRDNWEREARAMREQILEALGKTRFRVNGDQAHTVPH
ILNVSFDQLNAEALIVRLKDQVAIATGSACTSASYTPSHVLQAMGLPDDVAANGLRFSWF
PPQARDFDPLPIAETIARMQPQEG
NT seq 1155 nt   +upstreamnt  +downstreamnt
gtgagcgccgtggtggcgtatctggatgttgcggcgacgacacgggtggatccccgggta
gccgaggtcgtcctgcactggatgacagaggacttcggcaacgccggcagccgcacccat
gaatacggcgcccgcgccaagaaggctgtccagcaagcccgttcctatctcgcggacacc
gtaggcgcgaagaccgaggaagtgatcttcaccagcggggcgacggagtccaacaacatc
gccctgctcggcctcgctccacatggcgagcggaccggcaagaagcacatcatcacctcc
gccatcgaacacaaggccgtcctcgagcccctgttgcacctcgcggaaacccgcggcttc
accgtggacgttcttgagccgggtgcgtcaggccgaatcactgtcgagcaggtcatggag
cacgtgcgccccgacacactcgcggtgtctctgatgcacgtcaacaacgagaccggagtc
atccagccggtcgccgagctagccgagcgcctgcggtccacgccgacctacctccacgtg
gacgccgcccagggatacggcaagatcgccggcgatctgaccgcgccaatcgacctgatc
agcatcagcggccacaagatcggcgcaccgaagggggtcggagcgctcatcacacgacgt
cgcggctgggataaggctccactggagccgatcatgttcggcggtggccaggagaggaag
ctgcgtcccggaactctgccggtcccgctgatcatgggcctccacgaggccgcgcggatc
ttccacgagagccgggataactgggagcgcgaggcacgagcgatgcgtgagcagatcttg
gaagcgctcggcaagacacgcttccgggtcaacggagatcaggctcacaccgtgccgcac
atcctcaatgtctccttcgaccagctcaacgctgaagccttgattgtccgactcaaggat
caggtcgccattgcaacaggttcggcgtgcaccagcgcctcctacacccctagccacgtg
ctccaggctatgggccttcccgatgacgtggctgccaatgggctgcggttttcctggttc
cctccgcaagcgagggacttcgaccctcttcccattgccgaaaccattgcccgcatgcag
cctcaggaaggctga

DBGET integrated database retrieval system