KEGG   Streptomyces avermitilis: SAVERM_2773
Entry
SAVERM_2773       CDS       T00126                                 
Symbol
gcvT
Name
(GenBank) putative glycine cleavage system protein T (aminomethyltransferase)
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2773 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_2773 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_2773 (gcvT)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     SAVERM_2773 (gcvT)
SSDB
Motif
Pfam: GCV_T GCV_T_C
Other DBs
NCBI-ProteinID: BAC70484
NITE: SAV2773
UniProt: Q82JI2
Position
3402270..3403388
AA seq 372 aa
MSSNAPRHTALDALHRSLGATMTDFAGWDMPLRYGSERDEHLAVRSKAGLFDLSHMGEIT
VTGPGAAALLNYALVGNIASVGVGRARYTMICRADGGILDDLIVYRLQEQTYLVVANASN
AQVVLDALTERAGGFDAVVRDDRDAYALIAVQGPESPGILKSLTDADLDGLKYYAGLPGT
VAGVPALIARTGYTGEDGFELFVDPADAEKLWQALTEAGAPAGLVPCGLSCRDTLRLEAG
MPLYGHELSTSLTPFDAGLGRVVKFEKEGDFVGREALTEAAALAEKNPPRVLVGLIAEGR
RVPRAGYPVVVGGEVIGEVTSGAPSPTLGRPIAMAYVDAAHAAPGTAGVGVDIRGSHEPY
EVVALPFYRRQK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgagcagcaacgcaccccgtcacaccgcgctcgatgccctgcatcgctcgctgggcgcg
acgatgaccgacttcgcagggtgggacatgcccctgcgctacggctccgagcgcgacgag
cacctcgccgtccgcagcaaggccggtctcttcgacctctcccacatgggcgagatcacc
gtcaccggccccggggccgccgcgctcctgaactacgcgctggtcggcaacatcgcctcc
gtcggcgtcggccgcgcccgctacaccatgatctgccgggccgacggcggcatcctcgac
gacctgatcgtgtaccggctccaggagcagacgtacctggtcgtggccaacgcctccaac
gcccaggtcgtcctggacgcgctcaccgagcgggccggcggcttcgacgcggtcgtgcgc
gacgaccgtgacgcgtacgcgctgatcgccgtgcagggcccggagtcccccggcatcctc
aagtcgctgaccgacgcggacctggacggcctcaagtactacgcgggtctgccgggcacg
gtcgcgggcgtcccggcgctcatcgcccgcaccggctacacgggtgaggacggcttcgag
ctgttcgtcgaccccgcggacgccgagaagctgtggcaggcgctgaccgaggcgggcgcc
ccggccgggctcgtcccctgcggtctgtcctgccgggacacgctgcgcctggaggcgggc
atgccgctgtacgggcatgagctgagcacctcgctcacccccttcgacgcggggctcggg
cgggtcgtgaagttcgagaaggagggtgacttcgtggggcgcgaggcgctcaccgaggcc
gccgccctggccgagaagaacccgccgcgcgtcctcgtcggactgatcgccgagggccgc
cgggtgccgcgtgccgggtaccccgtcgtcgtcggcggcgaggtgatcggcgaggtcacc
tccggcgccccctcccccacgctgggcaggccgatcgcgatggcgtacgtcgacgccgcg
cacgcggcgccgggcacggccggggtcggcgtggacatccggggcagccacgagccgtac
gaggtcgtggcgctgccgttctaccggcgccagaagtga

DBGET integrated database retrieval system