KEGG   Streptomyces avermitilis: SAVERM_2823
Entry
SAVERM_2823       CDS       T00126                                 
Symbol
pta
Name
(GenBank) putative phosphotransacetylase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
sma  Streptomyces avermitilis
Pathway
sma00430  Taurine and hypotaurine metabolism
sma00620  Pyruvate metabolism
sma00640  Propanoate metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_2823 (pta)
   00640 Propanoate metabolism
    SAVERM_2823 (pta)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_2823 (pta)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SAVERM_2823 (pta)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     SAVERM_2823 (pta)
SSDB
Motif
Pfam: PTA_PTB DRTGG AAA_26
Other DBs
NCBI-ProteinID: BAC70534
NITE: SAV2823
UniProt: Q82JD2
Position
3467325..3469415
AA seq 696 aa
MTRSVYVTGIDRGDGRQVVELGVMELLTRQVDRVGVFRPLVHDGPDRLFELLRARYRLAQ
DPATVYGMDYHEASALQAEQGTDELMSTLVDRFHLVARDYDVVLVLGTDFADTQFPDELA
LNARLANEFGAAVIPVVGGRGQTAESVRAETRNAYRAYEGLGCDVLAMVVNRVAREDREE
LAARLDSLLAVPCYVLPDEPALSAPTVAQITHALGGKVLLGDDSGLARDALDFVFGGAML
PNFLNALTPGCLVVTPGDRADLVVGALAAHSAGTPPIAGVLLTLDERPSDEVLTLAARLA
PGTPVVSVAGTSFPTAAELFSLEGKLNAATPRKAETALGLFERYVDTGDLLKRVSAPSSD
RLTPMMFEHKLLEQARSDKRRVVLPEGTETRVLHAAEVLLRRGVCDLTLLGPVDQIRKKA
ADLGIDLGGSQLIDPVTSQLRDSFAEKYAQLRAHKGVSVELAYDVVADVNYFGTLMVQEG
LADGMVSGSVHSTAATIRPAFEIIKTKPDTKIVSSVFFMCLADKVLVYGDCAVNPDPNAE
QLCDIAVQSAATARQFGVEPRIAMLSYSTGTSGSGADVDKVREATELVRLRRDDLKIEGP
IQYDAAVEPSVAATKLPGSDVAGQASVLIFPDLNTGNNTYKAVQRSAGAIAVGPVMQGLR
KPVNDLSRGALVQDIVNTVAITAIQAQSPHEKATAQ
NT seq 2091 nt   +upstreamnt  +downstreamnt
gtgacgcgcagcgtgtacgtgaccggaatcgaccgcggcgacggccgccaggtcgtcgag
ctgggggtcatggagcttctgacccgccaggtcgaccgggtgggggtgttccgcccgctt
gtgcacgacggtcccgaccgcctcttcgagctgctgcgcgcccgctaccggctcgcccag
gacccggcgaccgtgtacggcatggactatcacgaggcgtccgcgctccaggccgagcag
gggaccgacgagctgatgtccacgctggtcgaccggtttcatctggtcgcgcgcgactac
gacgtcgtcctcgtcctcggcacggacttcgccgacacccagttccccgacgagctggcc
ctcaacgcccgcctcgcgaacgagttcggcgcggccgtgatccccgtggtcggcgggcgc
gggcagaccgccgagtcggtgcgcgccgagacccgtaacgcctaccgcgcgtacgagggg
ctcggctgcgacgtcctcgccatggtggtgaaccgggtggcccgagaggaccgcgaggaa
ctggccgcacggctcgattcccttctcgccgtgccctgttacgtactcccggacgagccg
gcgctctccgcgccgacggtcgcgcagatcacgcacgccctgggcggcaaggtgctcctc
ggcgacgactcggggctcgcccgggacgccctcgacttcgtgttcggcggtgcgatgctg
ccgaacttcctcaacgcgctgaccccggggtgtctggtggtcaccccgggcgaccgcgcc
gacctggtggtgggcgcgctcgccgcgcacagcgcgggcaccccgccgatagccggtgtg
ctgctcaccctcgacgagcggcccagcgacgaggtcctcaccctggccgcccggctcgcg
cccggcaccccggtggtctcggtggccggcaccagcttccccaccgcggccgaactgttc
tccctggaggggaagctgaacgcggcgacgccccgcaaggcggagaccgcactcggcctg
ttcgagcggtacgtcgacaccggcgacctgctgaagcgggtgtccgccccgagcagtgac
cggctcacgccgatgatgttcgagcacaagctcctggagcaggcccgctccgacaagcgg
cgcgtcgtgctgcccgagggcaccgagacgcgcgtcctgcacgccgccgaggtgctgctg
cgccggggcgtgtgcgatctgacgctgctcggcccggtcgaccagatccgcaagaaggcc
gccgacctgggcatcgatctgggcggctcccagctgatcgacccggtgacctcacagctg
cgggactccttcgccgagaagtacgcccagctccgggcccacaagggggtctcggtggag
ctggcctacgacgtcgtcgccgacgtcaactacttcgggacgctgatggtgcaggagggg
ctcgccgacggcatggtgtcgggctccgtgcactccacggccgccaccatccggcccgcg
ttcgagatcatcaagaccaagccggacacgaagatcgtgtcgtccgtcttcttcatgtgc
ctcgccgacaaggtgctggtgtacggcgactgcgcggtcaaccccgacccgaacgccgag
cagctgtgcgacatcgccgtccagtcggccgccaccgcccggcagttcggggtggagccg
cggatcgcgatgctgtcgtactcgacgggtacgtccggttcgggcgccgacgtcgacaag
gtgcgcgaggcgacggaactggtccggctgcgccgcgacgacctgaagatcgagggaccg
atccagtacgacgccgccgtcgagccgtccgtcgcggcgaccaagctgccgggctcggac
gtcgccgggcaggcgtccgtgctgatcttcccggacctcaacaccggcaacaacacctac
aaggccgtgcagcgctcggccggcgcgatcgccgtcggcccggtcatgcagggtctgcgc
aagcccgtcaacgacctgtcccgcggcgccctcgtgcaggacatcgtgaacaccgtcgcc
atcaccgcgatccaggcccagtccccccacgagaaggcgaccgcccagtga

DBGET integrated database retrieval system