KEGG   Streptomyces avermitilis: SAVERM_2843
Entry
SAVERM_2843       CDS       T00126                                 
Name
(GenBank) putative O-methyltransferase
  KO
K14251  C-methyltransferase [EC:2.1.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00253  Tetracycline biosynthesis
sma01057  Biosynthesis of type II polyketide products
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SAVERM_2843
   00253 Tetracycline biosynthesis
    SAVERM_2843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sma01008]
    SAVERM_2843
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-
     SAVERM_2843
Polyketide biosynthesis proteins [BR:sma01008]
 Polyketide tailoring proteins
  Methylase
   SAVERM_2843
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_12 Methyltransf_25 HTH_20 Dimerisation HTH_Crp_2 DOT1 PCMT
Other DBs
NCBI-ProteinID: BAC70554
NITE: SAV2843
UniProt: Q79ZD2
Position
complement(3488000..3488995)
AA seq 331 aa
MQLRELVFGAACAAAVRAAAKLGVADALGEKPATAEELAAVLGTEPRPLLRLLRALSCYG
IFAQNDDGRFVHTSMSRLLREDDPHSLRYISLWCTEPWTWDAWPRLDEAVRSGGSVFHEL
YGKGFFDYLHEDAHDSAQVFNQAMTTSSEQSARDVAELLDLTGVSTVADIGGGQGHVLAS
LLEKHPDIRGTLLDLPRVVEKADPRLRDGGPLAARARIVGADCREEIPVEADLYIIKNIL
EWDDDSTRRTLRNVMTKARPGARVVIIENLVDDTPSMKFTTSMDLMLLLNVGGAKHTKES
LVTRMTEAGLTVGEIRPVNAYLHAFECTVPA
NT seq 996 nt   +upstreamnt  +downstreamnt
atgcagctgagggagctcgtcttcggggcggcgtgcgccgcggccgtccgggcggcggcc
aagctcggcgtcgccgacgcgctcggcgagaagcccgccaccgcggaagaactcgcggcc
gtgctgggcaccgagccgcggcccctgctgaggctgctccgggccctgtcctgctacggc
atcttcgcgcagaacgacgacggacggttcgtccacaccagcatgtcccggctgctgcgc
gaagacgatccgcacagccttcggtacatctccctctggtgcaccgaaccctggacctgg
gacgcctggccgcggctcgacgaggcggtgcggtcgggcggcagcgtcttccacgagctg
tacggcaaggggttcttcgactacctgcacgaggacgcgcacgactccgcccaggtcttc
aaccaggccatgaccacgtccagcgagcagtcggcgcgggacgtcgcggagctcctcgac
ctgaccggcgtgtcgacggtcgccgacatcggcggcggccagggacatgtgctcgccagc
ctgctggagaagcacccggacatccggggaaccctgctcgacctgccccgcgtggtggag
aaggcggacccccggctgcgtgacggcggcccgctcgccgcgcgggcccggatcgtcggc
gcggactgccgcgaggagatcccggtcgaggccgacctgtacatcatcaagaacatcctg
gaatgggacgacgacagcacccgcagaaccctgcggaacgtgatgacgaaggcccgcccc
ggagccagggtcgtcatcatcgagaacctcgtcgacgacaccccgtcgatgaagttcacc
acgtccatggacctgatgctgctcctcaacgtcggaggagccaagcacaccaaggaaagc
ctggtcacccgcatgacggaggccggtctgaccgtcggtgagatccggccggtcaacgcg
tacctgcacgcgttcgaatgcaccgtacctgcctga

DBGET integrated database retrieval system