KEGG   Streptomyces avermitilis: SAVERM_2908
Entry
SAVERM_2908       CDS       T00126                                 
Symbol
glyA2
Name
(GenBank) putative serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00460  Cyanoamino acid metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00670  One carbon pool by folate
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
sma01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2908 (glyA2)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_2908 (glyA2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_2908 (glyA2)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAVERM_2908 (glyA2)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_2908 (glyA2)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     SAVERM_2908 (glyA2)
SSDB
Motif
Pfam: SHMT DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: BAC70619
NITE: SAV2908
UniProt: Q82J74
Position
complement(3639464..3640735)
AA seq 423 aa
MSVTHVPEAVRPAVAGADFEALRRQDPELAEILIGELDRQSTTLQLIAAENFTSPAVLAA
LGSPLANKYAEGYPGARYHGGCEFVDVAERLAVDRATALFGAAHANVQSHSGSSAVLAAY
AALLRPGDTVLAMGLPFGGHLTHGSPANFSGRWFDFVGYGVDAETGLIDYEQVRTLARSH
RPKAIVCGSISYPRHIDYAAFREIADEVGAHLIADAAHPIGLVAGGAAPNPVPYADVVCA
TTHKVLRGPRGGMILCGGELAERIDRAVFPFTQGGAQMHTIAAKAVAFGEAATPAFAAYA
RQVVANARVLAERLAAEGLAITTGGTDTHLLTVDPAPLGVEGRTARGRLAAAGMVLDTCA
LPHGDARGLRLGTAALTTQGMGETEMARVAKLFAGVLRDETDSKTAREEVRELAGGFPPY
PGR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgtcggtcacgcatgtaccggaagccgtacggcccgccgtcgccggggccgacttcgag
gcccttcgtcggcaggatcccgagctggccgagatcctcatcggggagctcgaccggcag
tcgaccacgttgcagctgatcgccgccgagaacttcacctcgccggccgtgctcgccgcc
ctcggctcaccgctcgccaacaagtacgccgaggggtaccccggtgcccggtaccacggc
ggctgcgagttcgtcgatgtcgccgagcgcctggccgtcgaccgggcgacggccctgttc
ggcgccgcgcacgccaatgtgcagtcgcactccggctcgtccgcggtgctcgccgcgtac
gccgcgctgctgcggcccggggacaccgtcctcgcgatgggcctgccgttcggcggccat
ctcacgcacggctcgcccgccaacttctccggccgctggttcgacttcgtcggctacggg
gtggacgccgagaccgggctcatcgactacgagcaggtgcgcaccctcgcacggtcgcac
cgcccgaaggccatcgtctgcggatccatctcctatccccggcacatcgactacgcggcg
ttccgcgagatcgccgatgaggtgggcgcccatctcatcgccgacgccgcccaccccatc
gggctcgtcgccgggggagcggcgcccaatccggtgccgtacgccgatgtcgtctgcgcc
accacccacaaggtgctgcgcggcccccgcggcggcatgatcctctgcggcggtgaactg
gccgagcgcatcgaccgggccgtcttcccgttcacgcagggcggcgcgcagatgcacacc
atcgccgccaaggccgtcgcgttcggcgaggcggcgaccccggctttcgccgcgtacgcc
cgtcaggtggtcgccaacgcgcgcgtgctcgccgagaggctggccgccgaggggctcgcg
atcaccaccggcggcacggacacccacctgctgaccgtcgatcccgcgccgctcggcgtg
gagggccgcaccgcccgcggccggttggccgccgcgggcatggtcctcgacacctgtgcc
cttcctcacggcgacgcccgcggtctgcgcctcggcacggccgcgctgaccacccagggg
atgggcgagaccgagatggcccgcgtcgccaagctgttcgcgggcgtgctgcgggacgag
accgacagcaagacggcacgtgaagaagtgcgggagctggctggtggatttccgccgtat
cccggccggtga

DBGET integrated database retrieval system