KEGG   Streptomyces avermitilis: SAVERM_2972
Entry
SAVERM_2972       CDS       T00126                                 

Symbol
sucA
Name
(GenBank) putative 2-oxoglutarate dehydrogenase
  KO
K01616  multifunctional 2-oxoglutarate metabolism enzyme [EC:2.2.1.5 4.1.1.71 1.2.4.2 2.3.1.61]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00630  Glyoxylate and dicarboxylate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_2972 (sucA)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2972 (sucA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SAVERM_2972 (sucA)
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.5  2-hydroxy-3-oxoadipate synthase
     SAVERM_2972 (sucA)
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAVERM_2972 (sucA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.71  2-oxoglutarate decarboxylase
     SAVERM_2972 (sucA)
SSDB
Motif
Pfam: E1_dh Transket_pyr 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Other DBs
NCBI-ProteinID: BAC70683
NITE: SAV2972
UniProt: Q82J10
Position
3724011..3727841
AA seq 1276 aa
MSPQSPSNSSISTDDQAGKNPAAAFGPNEWLVDEIYQQYLQDPNSVDRAWWDFFADYKPG
AAAASAPAGTAAAGAAETTTPAPAAPTAAAPAAPAAPAPAAPAPAPAAPAPAAAPAVPKP
AAAAPAPAAAKPAAAAPAQPKAAAATEAAEGPTFVPLRGPAAAVAKNMNASIEVPTATSV
RAVPVKLLFDNRIVINNHLKRARGGKISFTHLIGYAMVQAIKAMPSMNWHYAEKDGKPTL
VKPAHVNFGLAIDLVKPNGDRQLVVAGIKKAETLNFFEFWQAYEDIVRRARDGKLTMDDF
TGVTVSLTNPGGLGTVHSVPRLMPGQSVIMGVGSMDYPAEFQGTSQDTLNKLGISKVMTL
TSTYDHRVIQGAASGEFLRIVANFLLGEGGFYDEIFEALRIPYEPVRWLKDIDASHDDDV
TKAARVFELIHSYRVRGHVMADTDPLEYRQRKHPDLDITEHGLTLWDLEREFAVGGFAGK
SLMKLRDILGVLRDSYCRTTGIEFMHIQDPKQRKWIQDRIERSHSKPEREEQLRILRRLN
AAEAFETFLQTKYVGQKRFSLEGGESVIPLLDAVIDSAAESRLDEVVIGMAHRGRLNVLA
NIVGKSYAQIFREFEGNLDPKSMHGSGDVKYHLGASGTFTGLDGEQIKVSLAANPSHLET
VDPIIEGIARAKQDIINKGGTDFTVLPVALHGDAAFAGQGVVAETLNMSQLRGYRTGGTV
HIVINNQVGFTAAPESSRSSMYATDVARMIEAPIFHVNGDDPEAVVRVARLAFEFRQAFN
KDVVIDLICYRRRGHNESDNPAFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLEEAEQA
LQDFQGQLEKVFTEVREAISTPGEAPAPEPQPEFPVAVPTAVSQEVVKRIAESQVNIPDH
VTVHPRLLPQLQRRAAMIEDDTIDWGMGETLAIGSLLLEGTPVRLSGQDSRRGTFGQRHA
VLIDRVTGEDFTPLQYLADDQARLNVYDSLLSEYAVMGFEYGYSLARPDALVMWEAQFGD
FVNGAQTVVDEYISAAEQKWGQTSGVTLLLPHGYEGQGPDHSSARIERFLQLCAQNNMTV
AQPTLPSNYFHLLRWQVHNPHHKPLVVFTPKSMLRLKAAASKTEEFTTGAFRPVIGDDTV
DAAAVRKVVFCAGKLYYDLEAERKKRGATDAAAAETAIIRLERLYPLPGAELQAEIAKYP
NAEKYLWAQEEPANQGAWPFIALNLIDHLDLAVGADVPHGERLRRISRPHSSSPAVGSAK
RHQAEQEQLVREVFEA
NT seq 3831 nt   +upstreamnt  +downstreamnt
gtgtcgccacagtcccccagtaactcgagcatctcgaccgacgaccaagccgggaagaac
cccgctgcggccttcggacccaacgagtggctcgtcgacgagatctatcagcagtacctc
caggacccgaattcggtagaccgagcctggtgggacttcttcgccgattacaagccgggc
gcagctgccgcctcggctccggcgggtactgcggccgcgggggccgcagagaccaccacg
ccggctccggccgcgccgaccgctgcggcccccgccgctcccgcggcaccggctccggcc
gccccggcaccggctccggccgctccggctcccgcggccgctccggcggtcccgaagccc
gctgccgcggctccggccccggccgccgcgaagccggccgccgccgcgcccgcccagccg
aaggccgccgcggcgaccgaggccgccgagggccccacgttcgtcccgctgcgcggtccc
gccgccgcggtcgcgaagaacatgaacgcctcgatcgaggtgcccacggccacgtccgtg
cgcgcggtcccggtgaagctgctcttcgacaaccgcatcgtcatcaacaaccacctgaag
cgtgcccggggcgggaagatctccttcacccacctcatcgggtacgcgatggtgcaggcc
atcaaggccatgccgtcgatgaactggcactacgcggagaaggacgggaagcccaccctc
gtcaagcccgcgcacgtcaacttcggcctcgccatcgacctggtgaagcccaacggcgac
cgccagctcgtcgtcgccggcatcaagaaggccgagacgctgaacttcttcgagttctgg
caggcctacgaggacatcgtccgccgcgcccgtgacggcaagctgacgatggacgacttc
accggtgtcacggtctccctgaccaaccccggcggcctcggcaccgtccactcggtcccg
cgtctgatgcccggccagtcggtcatcatgggcgtcggctccatggactacccggcggag
ttccagggcacctcccaggacaccctgaacaagctcggcatctcgaaggtcatgacgctc
acgtcgacctacgaccaccgggtgatccagggcgccgcgtccggcgagttcctgcggatc
gtcgcgaacttcctcctcggcgagggcggcttctacgacgagatcttcgaggctctgcgg
atcccctacgagccggtccgctggctcaaggacatcgacgcctcgcacgacgacgacgtc
acgaaggccgcccgcgtcttcgagctgatccactcctaccgggtccgcggccacgtcatg
gccgacaccgacccgctggagtaccgccagcgcaagcaccccgacctggacatcaccgag
cacggcctcacgctctgggacctggagcgcgagttcgcggtcggcggcttcgcgggcaag
tccctgatgaagctgcgcgacatcctcggcgtgctgcgcgactcgtactgccgcaccacc
ggcatcgagttcatgcacatccaggaccccaagcagcgcaagtggatccaggaccgcatc
gagcgctcgcactccaagccggagcgcgaggagcagctgcgcatcctgcgccgcctgaac
gcggcggaggccttcgagaccttcctccagacgaagtacgtcggccagaagcgcttctcc
ctggagggcggcgagtccgtcatcccgctgctggacgcggtcatcgactccgccgccgag
tcccgcctggacgaggtcgtcatcggcatggcccaccgcggccgcctgaacgtgctcgcc
aacatcgtcggcaagtcgtacgcgcagatcttccgcgagttcgagggcaacctcgacccg
aagtcgatgcacggctccggcgacgtgaagtaccacctgggcgccagcggcaccttcacc
ggcctggacggcgagcagatcaaggtctcgctggccgccaacccgtcccacctggagacg
gtcgacccgatcatcgagggcatcgcccgcgccaagcaggacatcatcaacaagggcggc
acggacttcacggtcctgccggtcgccctgcacggtgacgcggccttcgcgggccagggc
gtggtggccgagaccctgaacatgtcgcagctgcgcggttaccgcacgggcggcacggtc
cacatcgtcatcaacaaccaggtcggcttcacggccgccccggagtcgtcgcgttcgtcg
atgtacgcgaccgatgtggcccgcatgatcgaggcgccgatcttccacgtgaacggcgac
gaccccgaggccgtcgtccgcgtcgcccgcctggccttcgagttccgccaggcgttcaac
aaggacgtcgtcatcgacctgatctgctaccgccgtcggggccacaacgagtccgacaac
ccggcgttcacgcagcccctgatgtacgacctgatcgacaagaagcgctcggtgcgcaag
ctctacaccgagtccctgatcggccggggcgacatcacgctggaagaggcggagcaggcg
ctccaggacttccagggccagctggagaaggtcttcaccgaggtccgcgaggccatctcc
accccgggcgaggcgccggctcccgagccgcagcccgagttcccggtggccgtgccgacc
gcggtctcccaggaggtcgtgaagcggatcgccgagtcccaggtcaacatccccgaccac
gtcaccgtgcacccgcggctgctgccgcagcttcagcgccgtgcggcgatgatcgaggac
gacacgatcgactggggcatgggcgagaccctggccatcggctcgctgctcctcgagggc
accccggtccgtctttcgggccaggactcccgccggggcacgttcggccagcgccacgcc
gtcctgatcgaccgggtcacgggcgaggacttcaccccgctccagtacctcgcggacgac
caggcgcgcctgaacgtctacgactccctgctctccgagtacgcggtcatgggcttcgag
tacggctactcgctggcccgccccgacgccctcgtgatgtgggaggcgcagttcggtgac
ttcgtcaacggcgcgcagacggtcgtcgacgagtacatctcggccgccgagcagaagtgg
ggccagacgtccggcgtcaccctgctcctcccgcacggctacgagggccagggtccggac
cactcctcggcccgtatcgagcgcttcctccagctgtgcgcgcagaacaacatgacggtc
gcccagccgacgctcccgtcgaactacttccacctcctgcggtggcaggtgcacaacccg
caccacaagccgctggtggtcttcaccccgaagtcgatgctgcgcctcaaggccgccgcc
tcgaagacggaggagttcaccacgggcgccttccgccccgtcatcggcgacgacaccgtc
gacgccgccgcggtccgcaaggtcgtcttctgcgccggcaagctgtactacgacctcgag
gccgagcggaagaagcgcggcgccacggacgcagcggctgccgagaccgcgatcatccgc
ctcgagcgcctgtacccgctgccgggtgccgagctccaggcggagatcgccaagtacccg
aacgccgagaagtacctgtgggcccaggaggagccggcgaaccagggcgcatggcccttc
atcgccctcaacctgatcgaccacctggacctggcggtcggcgcggacgttccgcacggg
gagcgactgcggcgcatctcccgcccgcacagctcttcgccggccgtgggttccgccaag
cggcaccaggctgagcaggagcagttggtgcgagaggtgttcgaggcgtag

DBGET integrated database retrieval system