KEGG   Streptomyces avermitilis: SAVERM_3059
Entry
SAVERM_3059       CDS       T00126                                 
Symbol
moaE
Name
(GenBank) putative molybdopterin biosynthesis protein E
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00790  Folate biosynthesis
sma01100  Metabolic pathways
sma01240  Biosynthesis of cofactors
sma04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAVERM_3059 (moaE)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAVERM_3059 (moaE)
Enzymes [BR:sma01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     SAVERM_3059 (moaE)
SSDB
Motif
Pfam: MoaE
Other DBs
NCBI-ProteinID: BAC70770
NITE: SAV3059
UniProt: Q82IS4
Position
complement(3820914..3821375)
AA seq 153 aa
MASMNDHPGEQAAQEPVKLLAIRETPLSLDEVFRAVGDDAAGGTALFVGTVRNHDGGADV
DELGYSCHPSAEAEMRRVAEKVVAEYPVRALAAVHRIGDLRVGDLAVVVAVSCPHRGEAF
EACRKLIDDLKHEVPIWKHQKFSDGTEEWVGAC
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcatccatgaacgaccaccccggcgagcaggccgcccaggagcccgtcaagctgctg
gccatccgtgagacgccgctctccctcgacgaggtcttccgggccgtcggggacgacgcg
gccggtgggaccgcactgttcgtggggaccgtgcggaatcacgacgggggcgccgacgtc
gacgagctggggtattcgtgtcaccccagcgccgaggccgagatgcggcgcgtcgccgag
aaggtcgtcgccgagtacccggtgcgggccctggccgccgtccaccgcatcggtgatctg
cgcgtgggtgatctcgccgtcgtcgtcgccgtgtcgtgcccccaccggggcgaggccttc
gaggcctgccggaagttgatcgacgacctcaagcacgaggtgcccatctggaagcaccag
aagttctccgacggcacggaggaatgggtcggcgcctgctga

DBGET integrated database retrieval system