KEGG   Streptomyces avermitilis: SAVERM_3072
Entry
SAVERM_3072       CDS       T00126                                 
Symbol
uvrD4
Name
(GenBank) putative ATP-dependent DNA helicase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03420  Nucleotide excision repair
sma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SAVERM_3072 (uvrD4)
   03430 Mismatch repair
    SAVERM_3072 (uvrD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3072 (uvrD4)
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     SAVERM_3072 (uvrD4)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SAVERM_3072 (uvrD4)
   MMR (mismatch excision repair)
    Other MMR factors
     SAVERM_3072 (uvrD4)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 HRDC UvrD_C_2 AAA_30 C1_1 AAA_12
Other DBs
NCBI-ProteinID: BAC70783
NITE: SAV3072
UniProt: Q82IR1
Position
complement(3833208..3835520)
AA seq 770 aa
MRLPPGRGGEPAALVRLQAPPCGQPPHPPPPTWQHGGVTAATHSTLFPQVPDSADAVLDG
LDPEQRAVATALHGPVCVLAGAGTGKTRAITHRIAYGVRAGILQPSSVLAVTFTNRAAGE
MRGRLRQLGASGVQARTFHSAALRQLQYFWPKAVGGGLPRIVDRKIQIVADAAAACRIRL
DRGELRDVTAEIEWSKVTQTVPADYAAAAAKAAREAPRDPAEIAQIYATYEDLKRDRAVI
DFEDVLLLTVGILQDRQDIAEAVRAQYQHFVVDEYQDVSPLQQRLLDLWLGERDSLCVVG
DASQTIYSFTGATPDHLLDFRTRHPGATVVKLVRDYRSSPQVVHLANGLLAQARGRAAEH
RLELISQREPGPEPVYTEYTDEPAEAEGAARRIRDLLASGVPAAEIAILFRTNSQSEIYE
QALADAGVPYQLRGAERFFDRPEVRKAGVALRGAARFGGNDTLLDDVVDLPSQVRAVLSG
EGWTSRPPAGSGAVRERWESLAALANLAQDFAAAKPDATLGDLVAELDERASAQHAPTVQ
GVTLASLHSSKGLEWDVVFLVGVAEGMMPITYAKTDEQIEEERRLLYVGVTRARQHLSVS
WALSRSPGGRPNRRPSRFLDGLRPGSVTTTGRGARAGAAGGIERGFAGSATSPAPRRTSR
IPARCRVCGRTLSDAGEMKLMRCEDCPSDMDEGLYERLREWRAVQAQRSGQPAFCVFTDK
TLMAIAEAVPDDEGDLARIPGVGVRKLNRYGADVLSICAGQEVEVGAEGD
NT seq 2313 nt   +upstreamnt  +downstreamnt
gtgcgtctgccgcccggacgcggcggcgagcctgccgcattagtacgactgcaggcgcct
ccctgtggacaaccgccgcacccgcctccgccgacctggcagcatggcggggtgacagca
gcaacgcactccaccctcttcccacaggttccggactctgccgacgcggtgctcgacggg
ctcgaccccgagcagcgcgcggtggcgaccgccctgcacgggccggtgtgcgtgctggca
ggtgccggcaccggcaagacacgcgccatcacccaccgcatcgcctacggggtgcgcgca
ggcatcctccagccctccagcgtgctcgccgtcaccttcaccaaccgcgccgccggcgag
atgcgcggccgactccgccagctcggcgcctccggtgtccaggcccgcacgttccactcc
gccgcgctgcgccagctccagtacttctggccgaaagcagtcggtggcggactccccaga
atcgtcgaccgcaagatccagatcgtcgcggacgcggcggccgcctgccgcatccgtctc
gaccggggcgagctgcgggacgtcaccgccgagatcgaatggtccaaggtcacccagacc
gtccccgccgactacgcggccgcggctgccaaggcagcccgcgaggccccccgggacccg
gccgagatcgcccagatctacgcaacgtacgaagacctcaagcgcgaccgcgccgtcatc
gacttcgaggacgtcctgctgctgaccgtgggcatcctccaggaccggcaggacatcgcg
gaggcggtccgcgcccagtaccagcacttcgtggtcgacgagtaccaggacgtcagcccc
ctccagcagcgcctcctggacctgtggctcggcgagcgcgacagcctgtgcgtcgtcggc
gacgccagccagacgatctactccttcaccggagcgacccccgaccacctgctcgacttc
cgcacccgccaccccggagccacggtcgtcaagctggtgcgcgactaccgctcctcgccc
caggtggtccacctcgccaacggcctgctcgcccaggcccgcggccgtgccgcggagcac
cgcctggagctgatctcccaaagagagcccggccccgaacccgtctacaccgaatacacc
gacgagccggccgaggccgaaggcgctgcccgccgcatccgcgacctcctggcctccggc
gtaccggcggccgagatcgccatcctgttccgcacgaactcccagtcggaaatctacgaa
caggccctcgccgacgccggagtgccctaccaactgcgcggcgccgagcggttcttcgac
cgccccgaggtgcgcaaggccggcgtcgccctgcgcggcgcggcccgcttcggcggcaac
gacacgctcctggacgacgtcgtcgacctgccctcccaggtgcgcgccgtgctctccgga
gagggctggaccagtcggcccccggccggctccggcgcggtccgggaacgctgggaatcg
ctggccgccctggcgaacctcgcccaggacttcgccgccgccaagcccgacgccaccctc
ggcgacctcgtggcggagctggacgagcgggcgagcgcccagcacgcaccgaccgtgcag
ggcgtcaccctcgcctcactgcactcctccaagggcctggagtgggacgtcgtcttcctg
gtcggtgtcgccgagggcatgatgccgatcacctacgccaagaccgacgaacagatcgag
gaagagcggcgcctcctgtacgtcggcgtcacccgcgccagacagcacctgtccgtctcc
tgggcactgtcccgctcacccggggggcgcccgaaccgccggcccagccgcttcctcgac
gggctgcgtcccggctcggtcaccaccacgggccgcggcgccagggccggcgccgcggga
ggcatcgagcgcggcttcgcgggctccgccaccagccccgccccgcgccgcaccagcagg
atcccggcccgctgccgggtctgcggccgcacgttgagcgacgcgggcgagatgaagctg
atgcgctgtgaggactgcccctcagacatggacgagggactctacgagcggttgcgtgag
tggcgggcggtgcaggcgcagcgcagcgggcagcccgcgttctgcgtcttcaccgacaag
accctgatggcgatcgccgaggccgtgcccgacgacgagggcgatctggcgcggatcccc
ggggtcggggtgcgcaagctcaatcgctacggagccgacgttctcagcatctgcgcaggt
caggaagttgaggtgggcgccgagggtgactga

KEGG   Streptomyces avermitilis: SAVERM_3076
Entry
SAVERM_3076       CDS       T00126                                 
Symbol
adnB
Name
(GenBank) putative ATP-dependent DNA helicase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03420  Nucleotide excision repair
sma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SAVERM_3076 (adnB)
   03430 Mismatch repair
    SAVERM_3076 (adnB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3076 (adnB)
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     SAVERM_3076 (adnB)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SAVERM_3076 (adnB)
   MMR (mismatch excision repair)
    Other MMR factors
     SAVERM_3076 (adnB)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 PDDEXK_1 AAA_30 UvrD_C_2
Other DBs
NCBI-ProteinID: BAC70787
NITE: SAV3076
UniProt: Q82IQ7
Position
complement(3838556..3842164)
AA seq 1202 aa
MLLPAMRLIGPPLSVAAASLSDVPARITDPEQLKELLGIPFTPEQTACITAPPAPQVIVA
GAGSGKTTVMAARVVWLVGTGQVAPEQVLGLTFTNKAAGELAERVRKALVKAGITDPDVI
DPDNPPGEPVISTYHAFAGRLLTDHGLRIGLEPTARLLADATRYQLAARVLREAPGPYPA
LTRSFPDLVGDLLTLDSELAEHLVRPEELRAYDAELLSSLEGAKLSNAELRKIPETAAAR
RELADLVVRYRAAKRERDLLDFGDQIALSATLARTRAEVGAILRDEFRVVLLDEYQDTSV
AQRVLLAGLFGGGTGHPVTAVGDPCQAIYGWRGASVANLDDFPEHFAHADGRLATRQALS
ENRRSGGRLLDLANGLAEPLRALHAGVEALRPAPGAEHDGQVRCALLRTHAEEIDWIADS
LAHLVRTGKEPGEIAVLCRTATDFAEIQGALVARDVPVEVVGLSGLLHLPEVADLVAVCE
VLQDPGANASLVRLLTGPRWRIGPRDLALLGRRARLLVSHARVGADDDPDRRLAAAVEGV
DPSEVISLADALDTFLEAPLEDPAEADDGLPFSADARVRFARLAAELRDLRRSLADPLMD
VLHRVLAVTGLEVELSASPHALAARRRETLSNFLDVAASFAASDGEATLLAFLGFLRTAA
QYEKGLDNALPGGENTVKVLTAHKSKGLEWDVVAVPGLVTGTFPSTQGREKWTAQGKVLP
HELRGDADTLPDIEAWDSRGMKAFHEAMKEHQHTEELRLGYVTFTRPRSLLLGSGHWWGP
SQKRPRGPSDFLHALYEHCAAGYGEIEAWAEEPEENEENPALHEAAADHAWPLPLDDTAL
ARRRAAAETVLAYLERVASHENAHPSAPSAVHDPTSYDDPDWPPPEDAESPHEDPFDEAY
GDLAHDEAPYGEDDVPEEGLLEDDGDDDADWESWSTDRPTVPHQAAAPEARPHPAGPPPL
TPEEARTIASWDRDLDALTGELLRARASVTDVPLPASLTASQLLELAADPDGFAQELARP
MPRPPQPAARRGTRFHAWVEARFEELRLPMLEPDELPGSEAEIADERDLEALKDAFERTP
YAHRTPYRVEVPFQLAIAGRVVRGRIDAVYRKEGNDGTTYEIVDWKTSRTRTADPLQLAV
YRLAWAEQQGVPLESVTTTFLYVRSGEVVRPDGLPDRAALERLLLDEPSSGEPPGERVTE
GR
NT seq 3609 nt   +upstreamnt  +downstreamnt
gtgcttcttccagccatgcggctgattggtcctccactgtcagtggccgccgctagcctc
tctgacgtgccagcccgtatcaccgaccccgagcagctcaaggagctcctcggcatcccg
ttcaccccggagcagacggcctgcatcaccgcaccgcccgccccgcaggtgatcgtggcc
ggagccggatcgggcaagaccaccgtgatggcggcacgcgtggtctggctggtcggtacc
gggcaggtggcccccgagcaggtgctgggcctgacgttcaccaacaaggccgccggtgaa
ctcgccgagcgcgtccgcaaggcactcgtcaaggcgggcatcacagacccggacgtgatc
gacccggacaacccgccgggcgagccggtgatctccacgtaccacgccttcgcgggccga
ctgctgaccgaccacggcctgcgcatcgggctcgaacccaccgcccgcctgctcgccgac
gccacccgctaccagctcgccgcgcgcgtgctgcgtgaggccccgggcccgtacccggcg
ctgacccgctccttcccggacctcgtcggcgatctcctcaccctcgactccgaactcgcc
gagcacctggtgcgccccgaggagctgcgcgcatacgacgccgagctgctgagctcactg
gagggcgccaagctctccaacgccgagctgcgcaagatccccgaaacggcagccgcccgt
cgtgagctggccgacctggtggtgcgctaccgggccgccaagcgcgagcgcgacctcctc
gacttcggtgaccagatcgccctctcggcgaccctggcacgcacgcgtgcggaggtcgga
gccatcctgcgggacgagttccgcgtagtgctcctcgacgagtaccaggacacatcggtc
gcccagcgcgtcctgctcgccgggctgttcggcggtggcaccgggcaccccgtgaccgcc
gtcggcgacccctgccaggcgatctacggctggcgcggcgcctccgtcgccaacctcgac
gacttccccgagcacttcgcgcacgccgacggccgcctcgcgacccgccaggccctcagc
gagaaccgccgcagcggcggccgcctcctcgacctcgccaacggcctcgccgagcccctg
cgcgccctgcacgcgggcgtggaggccctgcgcccggccccgggtgccgagcacgacggc
caggtccggtgcgcgctgctgcgcacccacgccgaggagatcgactggatcgccgactcc
ctcgcccacctcgtgcgcaccgggaaggagcccggcgagatcgccgtcctgtgccgcacc
gcgacggacttcgccgagatccagggcgcgctcgtcgcccgcgacgtccccgtcgaggtc
gtcggcctctccggactgctccatctgcccgaggtcgccgatctcgtcgccgtctgcgaa
gtcctccaggaccccggtgccaacgcctctctcgtacggctcctcaccggcccgcgctgg
cgcatcggcccgcgcgacctcgctcttctgggacggcgcgcccgcctgctcgtgtcccac
gcacgcgtgggggccgacgacgaccccgaccgccggctcgccgcggccgtcgagggggtc
gacccgtccgaggtgatctcgctcgcggacgcgctcgacacgttcctggaagcgcccctc
gaagatcccgcggaggcggacgacgggctgccgttctcggccgacgcgcgcgtacggttc
gcacggctcgccgccgaactgcgtgacctgcgccgctcgctcgccgaccccctgatggac
gtcctgcaccgggtcctcgccgtcaccggtctggaggtggagctgtccgcgtccccgcac
gcgctggccgcgcgccgacgcgagacgctgtcgaacttcctggacgtcgccgcatccttc
gccgcgagcgacggcgaggcgacgctccttgccttcctcggcttcctgcgcaccgccgcc
cagtacgagaagggtctcgacaacgcgctgccgggcggtgagaacaccgtcaaggtgctc
accgcgcacaagtccaagggcctggaatgggacgtcgtcgcggtccccgggctggtcacc
gggacgttcccgagcacccagggccgcgagaagtggaccgcgcagggcaaggtcctcccg
cacgagctgcgcggcgacgccgacacgctgcccgacatcgaggcctgggactccagaggc
atgaaggccttccacgaggccatgaaggagcaccagcacaccgaggagctccgcctcggc
tatgtcaccttcacccgcccccgctccctgctcctcggctccggccactggtggggcccg
tcccagaagcgcccgcggggtccgtcggacttcctgcacgccctgtacgagcactgcgcg
gccgggtacggcgagatcgaggcgtgggcggaggagcccgaggagaacgaggagaacccg
gccctgcacgaggcggccgccgaccacgcctggccacttcccctcgacgacacggcgctg
gcccgccgccgggcggccgccgagaccgtactcgcctacctggagcgagtcgcctcgcac
gagaacgcccacccctcggcgccctcggccgtccacgacccgacgtcgtacgacgacccg
gactggccgccaccggaggacgccgaaagcccccacgaagatcccttcgacgaggcctac
ggcgatctcgcccacgacgaggccccctacggggaggacgacgtcccggaggaaggcctc
ctcgaagacgacggcgacgacgacgccgactgggagtcctggtcgacggaccggccgacg
gtgccccaccaagcagcggctccggaggctcgtccccacccggcgggcccgccgcccctc
acgcccgaggaagcacgcaccatcgcctcctgggaccgcgacctggacgccctcaccgga
gagctgctgcgcgcccgcgcgagcgtcaccgacgtgcccctgccggcgtcgctgaccgcg
tcgcagctcctggagctggccgccgacccggacggcttcgcccaggagctcgcgcgcccc
atgccgcgccccccgcagcccgccgcacgccgcggcacccgcttccacgcctgggtcgag
gcccgcttcgaggagcttcggctgcccatgctggagccggacgagctgcccggcagcgaa
gccgagatcgccgacgaacgcgacctggaggccctcaaggacgccttcgaacgcactccc
tacgcccaccgcacgccgtaccgcgtggaggtccccttccagctcgcgatcgcgggacgc
gtcgtacgcggccgcatcgacgccgtctaccggaaagaggggaacgacgggacgacgtac
gagatcgtcgactggaagaccagccgcacccgcaccgcggaccccctccagctcgccgtg
taccggctcgcgtgggccgagcagcagggtgtgcccctggagtccgtcacgaccacattc
ctgtacgtacgcagcggcgaggtcgtacggcccgacggtctcccggaccgggccgcgctg
gagcggctgctcctggacgagccgtcctccggtgaaccgccgggcgagcgtgtcactgag
ggccgatag

KEGG   Streptomyces avermitilis: SAVERM_3463
Entry
SAVERM_3463       CDS       T00126                                 
Symbol
uvrD1
Name
(GenBank) putative ATP-dependent DNA helicase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03420  Nucleotide excision repair
sma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SAVERM_3463 (uvrD1)
   03430 Mismatch repair
    SAVERM_3463 (uvrD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3463 (uvrD1)
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     SAVERM_3463 (uvrD1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SAVERM_3463 (uvrD1)
   MMR (mismatch excision repair)
    Other MMR factors
     SAVERM_3463 (uvrD1)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Birna_VP4 ResIII
Other DBs
NCBI-ProteinID: BAC71175
NITE: SAV3463
UniProt: Q82HP5
Position
complement(4293057..4295642)
AA seq 861 aa
MSSLFDDSFLADLKPSRAHEEEPPPPPEDDHVPESVPDDLFGGKFDVPPDRDTYYRDGAP
RPAVDPATLLHGLNENQRAAVVHAGSPLLIVAGAGSGKTRVLTHRIAHLLGERHVHPGQI
LAITFTNKAAGEMKERVEQLVGPRANAMWVMTFHSACVRILRRESKRLGFTSSFSIYDAA
DSKRLMALVCRDLDLDPKRFPPKSFSAKISNLKNELIDEEDFAAQAADGFEKTLAQAYAM
YQSRLREANALDFDDLIMTTVNLLRAFPDVAEHYRRRFRHVLVDEYQDTNHAQYALVREL
VGVPGPGGGARPEDEPPREDDLEPAELCVVGDADQSIYAFRGATIRNILQFEEDYPDATT
ILLEQNYRSTQTILSAANAVIERNESRRPKNLWTNAGAGAQITGYVADTEHDEAQFVADE
IDRLTDAGEAKAGDVAVFYRTNAQSRVFEEIFIRVGLPYKVVGGVRFYERKEVRDVLAYL
RVLSNPEDSVPLRRILNVPKRGIGDRAEAMIDALSQREKISFAQALRRVDEAYGMAARST
NAVKRFNTLMEDLRTIAESGAGPATVLEAVLERTGYLAELQASTDPQDETRIENLQELAA
VALEFEQESGAGEEAATGDAAGDAAGDAAGDAPGGAPGAASGDLSAFLERVALVADSDQI
PDEEDGNGVITLMTLHTAKGLEFPVVFLTGMEDGVFPHMRSLGQTKELEEERRLAYVGIT
RARERLYLTRSSLRSAWGQPSYNPPSRFLEEIPDAHLEWKRKGASAAPLSSGPASGVAAS
LSSSRSRSAVSGASGFATRRGGASEKPVASLAVGDRVTHDQFGLGTVVGVKGTGGNAEAT
IDFGDTKPKRLLLRYAPVEKL
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgagcagcctctttgatgacagcttcctggcggacctcaagccctcgcgggcccacgag
gaggagcccccgccgccgcccgaggacgatcacgtaccggagtcggttccggacgatctg
ttcggcgggaagttcgacgtgccgccggaccgggacacgtactaccgcgacggagccccc
cgccccgccgtggacccggccacgctcctgcacgggctgaacgagaaccagcgcgcggcc
gtggtgcacgccggttcccccctgctcatcgtggccggtgccggctccggcaagacgcgc
gtgctcacgcaccggatcgcgcacctgctgggtgagcgccatgtgcaccccggccagatc
ctcgcgatcaccttcaccaacaaggccgcgggcgagatgaaggagcgcgtcgagcagctg
gtcggcccgcgcgccaacgcgatgtgggtgatgacgttccacagcgcgtgcgtgcgcatc
ctgaggcgtgaatcgaagaggctcgggttcacctcctccttctcgatctacgacgccgcc
gacagcaagcgtctgatggccctggtctgccgcgacctggacctcgaccccaagcgcttc
ccgccgaagtccttcagcgccaagatctcgaacctgaagaacgagctgatcgacgaggag
gacttcgccgcccaggccgcagacggcttcgagaagaccctcgcccaggcgtacgccatg
taccagtcgcggctgcgtgaggccaacgcgctcgacttcgacgacctgatcatgacgacg
gtcaacctgctgcgggccttcccggacgtcgccgagcactaccgccgccgtttccgccac
gtcctcgtcgacgagtaccaggacacgaaccacgcgcagtacgccctggtcagggagctg
gtcggggttccgggaccgggtggcggcgcccgcccggaggacgagccgccccgcgaggac
gacctcgagcccgccgagctgtgcgtcgtgggtgacgccgaccagtcgatctacgccttc
cgcggcgcgaccatccgcaacatcctccagttcgaggaggactacccggacgcgacgacg
atcctcctggagcagaactaccgctccacccagacgatcctcagcgcggccaacgcggtc
atcgagcgcaacgagtcccgtcgccccaagaacctgtggaccaacgcgggcgccggcgcg
cagatcaccggctatgtcgccgacaccgagcacgacgaggcgcagttcgtcgccgacgag
atagaccggctgacggacgcgggcgaggcaaaggcaggagacgtcgccgtcttctaccgg
acgaacgcgcagtcccgtgtcttcgaagagatcttcatccgcgtcggcctgccctacaag
gtcgtcggcggtgtccgcttctacgagcgcaaggaggtccgggacgtcctggcctacttg
cgggtcctgtccaacccggaggactcggtcccgctgcgccgcatcctgaacgtgcccaag
cgcggcatcggcgaccgcgcggaagcgatgatcgacgccctctcccagcgcgagaagatc
agcttcgcgcaggcgctgcgccgcgtcgacgaggcgtacgggatggcggcccgctccacg
aacgccgtcaagcggttcaacacgctgatggaggacctgcggacgatcgccgagtcgggc
gcgggcccggcgacggtcctggaggccgtgctcgaacgcaccggctacctggcggagttg
caggcgtcgacggacccgcaggacgagacccgcatcgagaaccttcaggaactcgccgct
gtggcgctggagttcgagcaggagtccggggcaggggaggaggccgcgacaggcgatgcg
gcgggcgacgcggcaggcgacgcggcaggcgacgcgccgggtggtgcgccgggcgcggcg
tcaggtgatctctcggcgttcctcgagcgggtcgcgctcgtcgccgactccgaccagatc
ccggacgaggaggacggcaacggagtcatcaccctgatgaccctgcacaccgccaagggc
ctcgaattcccggtcgtcttcctcaccggcatggaggacggcgtcttcccgcacatgcgg
tcgctcggccagaccaaggaactggaggaggagcggcgcctcgcgtacgtcggcatcacc
cgcgcgcgggagcggctgtacctcacccgttcgtccctgcgcagcgcgtggggccagccc
tcgtacaacccgccgtcccgcttcctggaggagatcccggacgcgcatctggagtggaag
cggaagggggcgtccgctgctccgctgtcttcggggccggcctcgggcgtggcggcctcg
ctgtcgtcgtcgcgctcgcgctccgcggtctcgggggcgtccggcttcgccacgcgccgg
ggcggtgcgtccgagaagccggtggcctcactggcggtcggggaccgggtcacgcacgac
cagttcggcctcggcacggtggtcggcgtgaagggcacgggcgggaacgcggaggcgacg
atcgacttcggcgacacgaagccgaagcggctgctgctccggtatgcgccggtggagaag
ctttag

DBGET integrated database retrieval system