KEGG   Streptomyces avermitilis: SAVERM_3121
Entry
SAVERM_3121       CDS       T00126                                 
Symbol
tagA
Name
(GenBank) putative DNA-3-methyladenine glycosylase I
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_3121 (tagA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3121 (tagA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     SAVERM_3121 (tagA)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_3121 (tagA)
SSDB
Motif
Pfam: Adenine_glyco HHH_2
Other DBs
NCBI-ProteinID: BAC70832
NITE: SAV3121
UniProt: Q82IL2
Position
complement(3894382..3894963)
AA seq 193 aa
MSSGALAGSDGVLRCPWALSTEDYVAYHDEEWGRPVHGDDALYERLCLEAFQSGLSWITI
LRRREGFRAAFAGFEIGKVADFTDADKERLLADPGIIRNRLKIEATVANARVLADWPAGE
LDELIWSFAPDPAARPVPRTLADVPAVTDESTALSKTLKKRGIRFIGPTTAYALMQACGL
VDDHLADCVARSH
NT seq 582 nt   +upstreamnt  +downstreamnt
gtgagcagcggtgccctggccggctcggacggcgtgctgcgctgcccgtgggccctgtcg
accgaggactacgtggcgtatcacgacgaggagtggggccgcccggtccacggcgacgac
gcgctgtacgagcggctgtgcctggaggccttccagtcgggcctgtcctggatcacgatc
ctgcgtcggcgggaggggttcagagccgccttcgccggcttcgagatcggcaaggtggcg
gacttcacggacgccgacaaggagcgcctgctcgccgatccgggcatcatccgcaaccgg
ttgaagatcgaggcgacggtcgccaacgcgcgcgtgctggccgactggccggccggtgaa
ctggacgagctgatctggtccttcgcccccgatccggccgcccgccccgtcccgaggacc
ctcgccgacgtgccggcggtcaccgacgagtcgacggccctctccaagaccctcaagaag
cgcggcatccgcttcatcggcccgacgacggcgtatgccctgatgcaggcgtgcgggctg
gtcgacgaccacctggcggactgcgtggcccggagccactga

DBGET integrated database retrieval system