KEGG   Streptomyces avermitilis: SAVERM_3181
Entry
SAVERM_3181       CDS       T00126                                 
Symbol
sdhA2
Name
(GenBank) putative succinate dehydrogenase flavoprotein subunit (complex II)
  KO
K00239  succinate dehydrogenase flavoprotein subunit [EC:1.3.5.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00190  Oxidative phosphorylation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3181 (sdhA2)
   00650 Butanoate metabolism
    SAVERM_3181 (sdhA2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_3181 (sdhA2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAVERM_3181 (sdhA2)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like FAD_oxidored Thi4 GIDA FAD_binding_3 Pyr_redox_3 AlaDh_PNT_C
Other DBs
NCBI-ProteinID: BAC70892
NITE: SAV3181
UniProt: Q82IG6
Position
3959816..3961819
AA seq 667 aa
MPVVDRQEWDVVVVGAGGAGLRAAIEARERGARTAVICKSLFGKAHTVMAEGGIAAAMGN
VNSGDNWQVHFRDTLRGGKFLNQWRMAELHAQEAPDRVWELETWGALFDRTKDGRISQRN
FGGHEYPRLAHVGDRTGLELIRTLQQKIVSLQQEDERETGDYESRLKVYQECTVTRVLKD
GAAVSGSAGGRVAGVFCYERESGRFFVLEAPSVVIATGGIGKSFKVTSNSWEYTGDGHAL
ALLAGAPLLNMEFVQFHPTGMVWPPSVKGILVTESVRGDGGVLRNSDGKRFMFDYIPDVF
KEKYAQSEEEGDRWYEDPDHNRRPPELLPRDEVARAINSEVKAGRGSPHGGVFLDVSTRM
PAEVIRRRLPSMYHQFKELADVDITAEAMEVGPTCHYVMGGIAVDSDTAAARGVPGLYAA
GEVAGGMHGSNRLGGNSLSDLLVFGRRAGLHAAQYAAGLPAGDRTGVDDIQVDTAAAEAL
RPFSAEGPEPGADSAGLGDVPRPPGGRPPENPYTLHQELQQTMNDLVGIIRREGEMEQAL
EKLADLRVRAGRAGVEGHRQFNPGWHLALDLRNMLLVSECVARAALERTESRGGHTREDH
PAMDRAWRRINLLCRLADPTGGLAAMDPARGQIDLTRDTTEPVRPDLLALFEKEELVKYL
AEEELYE
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgcccgtggtcgaccgccaggaatgggacgtcgtcgtggtcggcgcaggaggcgccgga
ctgcgcgccgccatcgaggcgcgggaacgcggcgcccgtaccgccgtgatctgcaagtcc
ctcttcggcaaggcacacaccgtgatggccgagggcggcatcgcggccgcgatgggcaac
gtgaactccggcgacaactggcaggtccacttccgcgacaccttgcgcggcggcaagttc
ctcaaccagtggcggatggccgagctgcacgcccaggaggcccccgaccgcgtctgggag
ctggagacctggggcgccctcttcgaccgtacgaaggacggccggatctcccagcgcaac
ttcggcggtcacgagtacccgcggctcgcgcacgtcggcgaccgcaccggcctcgaactg
atccgcacgctccagcagaagatcgtgtcgttgcagcaggaggacgagcgggagaccggc
gactacgagtcccgcctgaaggtctatcaggagtgcacggtcacccgggtcctgaaggac
ggcgccgccgtgagcggctccgccgggggacgggtcgccggcgtcttctgctacgagcgc
gagtccggccgcttcttcgtcctcgaggcgccctcggtcgtgatcgcgaccggcggcatc
ggcaagtccttcaaggtgacgtcgaactcgtgggagtacacgggcgacgggcacgcgctg
gcgctgctcgccggagcgcccctgctgaacatggagttcgtgcagttccacccgacgggc
atggtctggccgccgtcggtgaagggcatcctcgtcaccgagtcggtgcgcggcgacggc
ggcgtgctcaggaactccgacggcaagcggttcatgttcgactacatccccgacgtcttc
aaggagaagtacgcgcagtcggaggaggagggcgaccgctggtacgaggacccggaccac
aaccgccgcccccctgagctgctgccccgggacgaggtcgcgcgcgccatcaactccgag
gtcaaggcgggccgcggctccccccacggcggcgtcttcctggacgtctcgacgcgtatg
ccggccgaggtgatccggcgccggctcccctccatgtaccaccagttcaaggagctggcg
gacgtcgacatcaccgccgaggcgatggaggtcggcccgacctgccactacgtgatgggc
ggcatcgcggtcgactcggacaccgcggcggcccgcggcgtaccgggtctgtacgcggcc
ggggaggtggccggcggcatgcacggctccaaccggctcggcggcaactcgctgtccgac
ctgctggtcttcggccggcgggcggggctgcacgcggcccagtacgcggcgggcctgccg
gccggggaccgcaccggcgtggacgacatccaggtcgacacggcggccgccgaggcactg
cggcccttctcggccgagggtccggagccgggcgcggacagtgccggcctgggggacgta
ccccggccccccggtggccgcccgccggagaacccgtacaccctgcaccaggaactccag
cagacgatgaacgacctcgtcggcatcatccgccgcgagggcgagatggaacaggcgctg
gagaagctggcggacctgcgggtacgggcggggcgggccggggtggaggggcaccggcag
ttcaaccccggctggcatctggccctcgacctgcggaacatgctcctggtcagcgaatgt
gtggcacgcgcggctctggagcgcacggagtcccggggcggtcacacacgcgaggaccac
ccggcgatggaccgcgcgtggcgtcgtatcaaccttctgtgccgactggccgaccctacg
ggcgggttggcggcgatggaccccgcccgcggccagatcgacctcacccgggacaccacc
gaacccgtccgccccgacctgctcgccctcttcgagaaggaggagctggtcaagtacctg
gccgaagaggagctgtacgagtga

KEGG   Streptomyces avermitilis: SAVERM_3182
Entry
SAVERM_3182       CDS       T00126                                 
Symbol
sdhB2
Name
(GenBank) putative succinate dehydrogenase iron-sulfur protein (complex II)
  KO
K00240  succinate dehydrogenase iron-sulfur subunit [EC:1.3.5.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00190  Oxidative phosphorylation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3182 (sdhB2)
   00650 Butanoate metabolism
    SAVERM_3182 (sdhB2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_3182 (sdhB2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAVERM_3182 (sdhB2)
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_7 Fer4_18 Fer4_9 DM10_dom Fer4_10
Other DBs
NCBI-ProteinID: BAC70893
NITE: SAV3182
UniProt: Q82IG5
Position
3961816..3962592
AA seq 258 aa
MTSYEARFKVWRGDVKGGGLEDFEVEVNDGEVVLDIIHRLQATQAPDLAVRWNCKAGKCG
SCSAEVNGRPRLMCMTRMSVFTREETITVTPLRAFPVVRDLVTDVGFNYAKAREVPAFVP
PAGLGPGEYRMQQEDVERPQEFRKCIECFLCQDTCHVVRDHEENKPAFAGPRFLMRVAEL
DMHPLDAAADTGLDRKRTAQDDHGLGYCNITKCCTEVCPEGIKITDNALIPLKERAVDRK
YDPLVWLGSKIGRRPRPS
NT seq 777 nt   +upstreamnt  +downstreamnt
gtgaccagctatgaggcccgcttcaaggtgtggcgcggggatgtgaagggcggtggcctg
gaggacttcgaggtcgaggtgaacgacggcgaggtggtgctggacatcatccaccgcctc
caggcgacccaggcccccgatctggccgtgcgctggaactgcaaggcgggcaagtgcggt
tcgtgctcggctgaggtcaacgggcggccgcggctgatgtgcatgacgcgcatgtcggtg
ttcacccgggaggagacgatcaccgtcacgccgctgcgcgccttcccggtcgtacgggac
ctggtgaccgacgtgggcttcaactacgcgaaggcgcgcgaggtcccggccttcgtgccg
ccggccggcctgggccccggcgagtaccggatgcagcaggaggacgtggaacgcccgcag
gagttccgcaagtgcatcgagtgcttcctgtgccaggacacgtgccatgtcgtccgcgac
cacgaggagaacaaaccggcgttcgcgggcccgcgcttcctgatgcgggtcgccgagctg
gacatgcaccccctggacgccgccgccgacaccggcctggaccgtaagcgcacggcccag
gacgaccacggcctcggctactgcaacatcaccaagtgctgcacggaggtctgccccgag
ggcatcaagatcacggacaacgccctgattcccttgaaagaaagggcggtcgaccgcaag
tacgacccgctggtgtggctgggatcgaagatcggaaggcggcctcgtccgtcgtag

KEGG   Streptomyces avermitilis: SAVERM_3395
Entry
SAVERM_3395       CDS       T00126                                 
Symbol
sdhC1
Name
(GenBank) putative succinate dehydrogenase cytochrome b-556 subunit (complex II)
  KO
K00241  succinate dehydrogenase cytochrome b subunit
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00190  Oxidative phosphorylation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3395 (sdhC1)
   00650 Butanoate metabolism
    SAVERM_3395 (sdhC1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_3395 (sdhC1)
SSDB
Motif
Pfam: Sdh_cyt Ferric_reduct Fumarate_red_C CPT
Other DBs
NCBI-ProteinID: BAC71107
NITE: SAV3395
UniProt: Q82HW3
Position
4217404..4217784
AA seq 126 aa
MPAGTLYRGREGMWSWVAHRVTGVLIFFFLFVHVLDTALVRVSPEDYDKVVSTYKTPIVA
VLEYGLVAAILFHALNGLRVIAVDFWSKGPRYQKQMLWSVVVLWLVLMIGAIYPVLGHAA
RELFGS
NT seq 381 nt   +upstreamnt  +downstreamnt
gtgccggctggaacgctgtaccgcggccgggaaggaatgtggtcctgggtggctcatcga
gtcaccggcgtcctcatcttcttcttcctgttcgtacacgtgctggacaccgctcttgtc
cgtgtctcccccgaggactacgacaaggtcgtgtccacgtacaagacgccgatcgtcgcc
gtgctggagtacggcctggtcgccgccatcctcttccacgcgctcaacggcctgcgtgtc
atcgccgtcgacttctggtccaagggcccgcgctaccagaagcagatgctctggtccgtg
gtcgtcctgtggctcgtgctgatgatcggggcgatctaccccgtcctcggccacgccgct
cgtgaactgttcgggagctga

KEGG   Streptomyces avermitilis: SAVERM_3396
Entry
SAVERM_3396       CDS       T00126                                 
Symbol
sdhD
Name
(GenBank) putative succinate dehydrogenase hydrophobic membrane anchor protein (complex II)
  KO
K00242  succinate dehydrogenase membrane anchor subunit
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00190  Oxidative phosphorylation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3396 (sdhD)
   00650 Butanoate metabolism
    SAVERM_3396 (sdhD)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_3396 (sdhD)
SSDB
Motif
Pfam: Sdh_cyt CybS
Other DBs
NCBI-ProteinID: BAC71108
NITE: SAV3396
UniProt: Q82HW2
Position
4217790..4218272
AA seq 160 aa
MSTTDTAASGIGPVEGASLYGVDNPAPVIESPRKRTKKTPKSTRGNFEMYGWLFMRLSGI
VLVVLVLGHLLIQLVLDGGVSKIGFAFVAGRWASPWWQVWDLAMLWLAMLHGANGLRTII
NDYAERANTRLWLKGLLYTATVFTILLGTLVIFTFDPNIR
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtccacgactgataccgccgcctccgggatcggccccgtagagggcgcctcgctgtac
ggcgtcgacaacccggcgcccgtcatcgagtcgccgcgcaagcggacgaagaagaccccg
aagtccacccgtggcaacttcgagatgtacggctggctgttcatgcgcctgtccggcatc
gtgctggtcgtcctggtcctcggccacctgctgatccagctcgtcctcgacggcggcgtc
tccaagatcggcttcgccttcgtggcaggccgctgggcgtccccgtggtggcaggtctgg
gacctggccatgctgtggctcgcgatgctgcacggcgccaacggcctgcgcacgatcatc
aacgactacgcggagcgggcgaacacgcgcctgtggctgaagggcctgctgtacaccgcc
acggtgttcacgattctgctgggcacgctggtgatcttcaccttcgacccgaacatccgc
tag

KEGG   Streptomyces avermitilis: SAVERM_3397
Entry
SAVERM_3397       CDS       T00126                                 
Symbol
sdhA1
Name
(GenBank) putative succinate dehydrogenase flavoprotein subunit (complex II)
  KO
K00239  succinate dehydrogenase flavoprotein subunit [EC:1.3.5.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00190  Oxidative phosphorylation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3397 (sdhA1)
   00650 Butanoate metabolism
    SAVERM_3397 (sdhA1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_3397 (sdhA1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAVERM_3397 (sdhA1)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 HI0933_like DAO Pyr_redox_2 FAD_oxidored Pyr_redox_3 GIDA
Other DBs
NCBI-ProteinID: BAC71109
NITE: SAV3397
UniProt: Q82HW1
Position
4218295..4220049
AA seq 584 aa
MKIHKYDTVIVGAGGAGMRAAIEATKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEED
NWEWHTFDTVKGGDYLVDQDAAEILAKEAIDAVLDLEKMGLPFNRTPEGRIDQRRFGGHS
RNHGEAPVRRSCYAADRTGHMILQTLYQNCVKEGVEFFNEFYVLDQLIVEEDGVKKSAGV
VAYELATGEIHVFQAKAVIYASGGTGKFFKVTSNAHTLTGDGQAAVYRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPEGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYAMGGIP
TNVEGEVLSDNTTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYSAK
AGYLELPEDPAAQVVSQVERLRASTGTERVATLRLELQETMDANVMVFRTEQTIKTAVEK
IAELRERYLNVSIQDKGKRFNTDLLEAIELGNLLDLAEVMAVSALARKESRGGHYREDYP
NRDDVNFMRHTMAYREVGDDGTESIRLDYKPVVQTRYQPMERKY
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgaagatccacaagtacgacaccgtcatcgtcggcgccggcggcgccggtatgcgcgcc
gccatcgaggcgacgaagcgcagccgcaccgccgtgctcacgaagctctaccccacccgc
tcccacacgggcgccgcgcagggcggcatggccgccgcgctggccaacgtggaggaggac
aactgggagtggcacaccttcgacaccgtcaagggcggtgactacctggtcgaccaggac
gccgccgagatcctggcgaaggaggccatcgacgccgtcctcgacctggagaagatgggc
cttcccttcaaccggacgcccgagggcaggatcgaccagcgccgcttcggcggtcactcc
cgcaaccacggcgaggcgccggtccgccggtcctgctacgcggccgaccgcaccggtcac
atgatcctccagacgctgtaccagaactgcgtgaaggagggcgtggagttcttcaacgag
ttctacgtcctcgaccagctcatcgtcgaggaagacggcgtcaagaagtccgccggcgtc
gtcgcgtacgagctggcgaccggcgagatccacgtcttccaggcgaaggccgtgatctac
gcgtccggcggcaccggcaagttcttcaaggtgacgtcgaacgcgcacacgctgaccggt
gacggccaggccgccgtctaccgtcgcgggctgccgctggaggacatggagttcttccag
ttccacccgaccggcatctggcgcatgggcatcctgctgacggagggcgcccgcggtgag
ggcggcatcctccgcaacaaggacggcgagcgcttcatggagaagtacgcgccggtcatg
aaggacctcgcgtcccgtgacgtcgtgtcccgctccatctacacggagatccgtgagggc
cgcggctgcggtcccgagggcgaccacgtctacctcgacctcacgcacctcccgccggag
cagctggacgccaagctcccggacatcacggagttcgcgcgtacgtacctcggcatcgag
ccctacacggacccgatcccgatccagcccaccgcgcactacgccatgggcggcatcccg
acgaacgtcgagggtgaggtcctctcggacaacaccaccgtcgtcccgggcctgtacgcg
gccggcgaggtcgcctgtgtctccgtgcacggcgccaaccggctcggcaccaactcgctg
ctcgacatcaacgtcttcgggcgtcgcgcgggcatcgccgcggccgagtactcggcgaag
gccggctacctcgagctgcccgaggaccctgccgcgcaggtcgtctcgcaggtcgagcgc
ctgcgcgcctccacgggcacggagcgggtcgccacgctgcgcctggagctccaggagacc
atggacgcgaacgtcatggtgttccgcaccgagcagacgatcaagacggcggtcgagaag
atcgcggagctgcgcgagcggtacctgaacgtctcgatccaggacaagggcaagcggttc
aacacggacctcctcgaggccatcgagctgggcaacctgctcgacctggccgaggtcatg
gccgtctccgcgctcgcccgcaaggagtcccgcggcggtcactaccgcgaggactacccg
aaccgcgacgacgtcaacttcatgcgccacaccatggcgtaccgcgaggtcggcgacgac
ggcaccgagtccatccgtctcgactacaagccggtcgtccagacccgctaccagccgatg
gagcgtaagtactga

KEGG   Streptomyces avermitilis: SAVERM_3398
Entry
SAVERM_3398       CDS       T00126                                 
Symbol
sdhB1
Name
(GenBank) putative succinate dehydrogenase iron-sulfur protein (complex II)
  KO
K00240  succinate dehydrogenase iron-sulfur subunit [EC:1.3.5.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00190  Oxidative phosphorylation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3398 (sdhB1)
   00650 Butanoate metabolism
    SAVERM_3398 (sdhB1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_3398 (sdhB1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAVERM_3398 (sdhB1)
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4_7 Fer4_16 Fer4_4 Fer4 Fer4_18 Fer4_6 Fer4_2 Fer4_21 Fer4_15 Fer2
Other DBs
NCBI-ProteinID: BAC71110
NITE: SAV3398
UniProt: Q82HW0
Position
4220049..4220822
AA seq 257 aa
MATPTLDKADSKPEAGFADSPYITVTLRIRRFNPEISAEAAWEDFQLEIDPKERVLDALH
KIKWDQDGSLTFRRSCAHGICGSDAMRINGKNRLACKTLIKDINPEKPITVEAIKGLTVL
KDLVVDMEPFFQAYRDVMPFLITKDTNEPTRERLQSAEDRERFDDTTKCILCAACTSSCP
VFWNDGQYFGPAAIVNAHRFIFDSRDEAGEQRLEILNDKDGVWRCRTTFNCTDACPRGIE
VTKAIQEVKRALITRRF
NT seq 774 nt   +upstreamnt  +downstreamnt
atggctaccccgaccctcgacaaggcggacagcaagcccgaggcgggcttcgccgactcg
ccgtacatcacggtcaccctccggatccgccgcttcaacccggagatctcggccgaggcc
gcctgggaagacttccagctggagatcgacccgaaggaacgcgtcctcgacgccctgcac
aagatcaagtgggaccaggacggaagcctcaccttccgccgctcctgcgcgcacggcatc
tgcggctcggacgccatgcggatcaacggcaagaaccgtctggcctgcaagacgctgatc
aaggacatcaaccccgagaagccgatcacggtcgaggccataaagggcctgacggtcctc
aaggacctggtcgtcgacatggagccgttcttccaggcgtaccgggacgtgatgcccttc
ctgatcacgaaggacaccaacgagccgacgcgcgagcgacttcagtccgccgaggaccgc
gagcgcttcgacgacaccacgaagtgcatcctgtgcgccgcgtgcacgtcgtcgtgcccg
gtgttctggaacgacggccagtacttcggtccggccgcgatcgtcaacgcccaccgcttc
atcttcgactcgcgtgacgaggccggggagcagcgcctggagatcctcaacgacaaggac
ggcgtgtggcgctgccgcacgacgttcaactgcacggacgcctgcccgcgcggtatcgag
gtcacgaaggcgatccaggaagtgaagcgggcgctgatcacgcgccgcttctga

KEGG   Streptomyces avermitilis: SAVERM_7307
Entry
SAVERM_7307       CDS       T00126                                 
Symbol
sdhC2
Name
(GenBank) putative succinate dehydrogenase cytochrome b-556 subunit (complex II)
  KO
K00241  succinate dehydrogenase cytochrome b subunit
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00190  Oxidative phosphorylation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_7307 (sdhC2)
   00650 Butanoate metabolism
    SAVERM_7307 (sdhC2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_7307 (sdhC2)
SSDB
Motif
Pfam: Sdh_cyt
Other DBs
NCBI-ProteinID: BAC75018
NITE: SAV7307
UniProt: Q825Y6
Position
8715169..8715876
AA seq 235 aa
MALATRTDRRSSMARTVWDSSVGKKTVMAVSGLVMLLYLVVHMIGNLKIFFGSGEFNHYA
HWLRTLGEPFLHYEWALWIIRVALVAAVVAHATAAYQLSRRDIRARPSKYVHRKARASYA
TRTMRWGGVILGLFIVWHILDLTTGSVHPGGFQSGHPYQNVVDTFSTWYGNIIYIVAMLA
LGLHIRHGFWSAAQTLGAGSRTRDRALKTVANVLALLLTAGFVAVPVGVMTGVVS
NT seq 708 nt   +upstreamnt  +downstreamnt
atggctctggcaacacggacggaccgacggtcgtccatggcacgcaccgtctgggacagc
tccgtcggcaagaaaacggtcatggcggtgagcgggctcgtcatgctgctctacctggtc
gtccacatgatcggcaatctgaagatcttcttcggatccggtgagttcaaccactacgcc
cactggctgcgcaccctcggcgagcctttcctccactacgagtgggcgctgtggatcatc
cgcgtggccctcgtcgccgccgtcgtcgcccacgccaccgccgcctaccagctgagccgg
cgcgacatcagggcgcgccccagcaagtacgtgcaccggaaggcgcgggccagctacgcc
acgcgcaccatgcgctggggcggcgtcatcctcggcctcttcatcgtctggcacatcctc
gacctgacgacgggctccgtgcacccgggcggattccagtccggccacccgtaccagaac
gtggtcgacaccttctccacctggtacggcaacatcatctacatcgtcgcgatgctcgcg
ctcggcctgcacatccggcacggcttctggagcgccgcccagacgctcggcgccggcagc
cgcacccgcgaccgcgccctcaagaccgtcgccaatgttctcgcgctgctgctcacggcg
ggcttcgtcgccgtacccgtgggcgtcatgaccggagtggtgagctga

KEGG   Streptomyces avermitilis: SAVERM_7308
Entry
SAVERM_7308       CDS       T00126                                 
Symbol
sdhA3
Name
(GenBank) putative succinate dehydrogenase flavoprotein subunit (complex II)
  KO
K00239  succinate dehydrogenase flavoprotein subunit [EC:1.3.5.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00190  Oxidative phosphorylation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_7308 (sdhA3)
   00650 Butanoate metabolism
    SAVERM_7308 (sdhA3)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_7308 (sdhA3)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAVERM_7308 (sdhA3)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 GIDA NAD_binding_8 YjeF_N
Other DBs
NCBI-ProteinID: BAC75019
NITE: SAV7308
UniProt: Q825Y5
Position
8715880..8717829
AA seq 649 aa
MHSYADYATGEPVVDSKAPQGPINERWDTRRFEAKLVNPANRRKHTVIVVGTGLAGGSAG
ATLAEQGYHVVQFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSVHRLFYDTVKGGDFRAR
ESNVHRLAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQVSRTFYARGQTGQQLLLG
AYQALSRQIAAGNIEMHPRTEMLDLIVVDGRARGIVARDLITGRIDTYFADAVVLASGGY
GNVFYLSTNAMNSNATAVWRAHRRGAYFANPCFTQIHPTCIPRTGDHQSKLTLMSESLRN
DGRIWVPKAKGDQRPANEIPEDERDYYLERIYPSFGNLVPRDIASRAAKNVCDEGRGVGP
GGQGVYLDFADAIRRMGRAKVEEKYGNLFDMYARITAEDPYTVPMRIYPAVHYTMGGLWV
DYDLQTTIPGLFAIGEANFSDHGANRLGASALMQGLADGYFVLPSTINDYLARNPHPEEV
TAEHPVVQEMLADTEDRLRLLLAVDGDRTPDSFHRELGELMWEFCGMARTESGLRKALER
IPQIREEFWRRIKVPGVGEEFNQSLEKANRIVDYLELAELMCLDALHRSESCGGHFREES
QTPDGEAARRDEAFSYAAAWEFTDTGDAPVLHKEDLVFEYVHPTQRSYA
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgcattcctacgcggactacgcgaccggtgagccggtcgtcgacagcaaggccccgcag
ggcccgatcaacgagcggtgggacacccgccgtttcgaggccaaactggtcaaccccgcc
aaccgccgcaagcacacggtgatcgtcgtcggcaccggcctcgcgggcggctccgccggc
gccacgctcgccgaacagggctaccacgtcgtccagttctgctaccaggactccccgcgc
cgcgcccactcgatcgccgcgcagggcggcatcaacgcggcgaagaactaccgcaacgac
ggcgactccgtccaccggctgttctacgacaccgtcaagggcggcgacttcagggcgcgg
gagtcgaacgtccaccggctcgcgcagatctcggtcgagatcatcgaccagtgcgtggcg
cagggcgtgccgttcgcccgggagtacggcggtctgctcgacacccgctccttcggcggc
gtacaggtctcgcgcaccttctacgcccgtggtcagacgggtcagcaactgctgctcggc
gcgtaccaggcgctgtcgcggcagatcgccgcgggcaacatcgagatgcatccgcgcacc
gagatgctcgacctgatcgtcgtcgacggacgggcgcgcgggatcgtggccagggatctc
atcaccggccgcatcgacacgtacttcgcggacgcggtggtgctggccagcggtggctac
ggcaatgtcttctacctctcgacgaacgccatgaactccaacgccaccgccgtctggcgg
gcgcaccggcgcggcgcctacttcgccaacccctgcttcacccagatccaccccacctgt
atcccgcgcaccggcgaccaccagtccaagctcacgctgatgagcgagtcgctgcgcaac
gacggccgcatctgggtgccgaaggcgaagggcgaccagcggcccgcgaacgagatcccc
gaggacgagcgcgactactacctggagcgcatctacccctccttcggcaacctcgtaccg
cgcgacatcgcctcccgcgccgcgaagaacgtctgcgacgagggcaggggagtgggcccc
ggcgggcagggcgtctacctggacttcgccgacgccatcaggcgcatgggccgggcgaag
gtcgaggagaagtacggcaacctcttcgacatgtacgcgcggatcaccgccgaggacccg
tacacggtccccatgcggatctaccccgccgtgcactacacgatgggcggcctctgggtc
gactacgacctgcagaccacgatcccgggcctgttcgcgatcggcgaggccaacttctcg
gaccacggggcgaaccggctgggtgcctcggccctgatgcagggcctcgccgacggctac
ttcgtgctcccctccacgatcaacgactacctcgcgcgcaacccgcaccccgaggaggtg
acggccgaacaccccgtcgtccaggagatgctggccgacaccgaggaccggctgcggttg
ctgctcgccgtcgacggcgaccgcacccccgactccttccaccgcgaactcggcgaactc
atgtgggagttctgcggcatggcccgcaccgagagcggactgcgcaaggcgctcgaacgc
atcccgcagatccgcgaggagttctggcggcgcatcaaggtccccggcgtcggcgaggag
ttcaaccagtccctggagaaggccaaccgcatcgtcgactacctcgaactcgccgagctg
atgtgcctcgacgcactgcaccggtccgagtcctgcggtggtcacttccgcgaggagtcc
cagaccccggacggcgaggcggcccgcagggacgaggcgttctcgtacgcggccgcctgg
gagttcaccgacaccggcgacgcgcccgtcctgcacaaggaagacctcgtcttcgagtac
gtccaccccactcagcggagctacgcatga

KEGG   Streptomyces avermitilis: SAVERM_7309
Entry
SAVERM_7309       CDS       T00126                                 
Symbol
sdhB3
Name
(GenBank) putative succinate dehydrogenase iron-sulfur protein (complex II)
  KO
K00240  succinate dehydrogenase iron-sulfur subunit [EC:1.3.5.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00190  Oxidative phosphorylation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_7309 (sdhB3)
   00650 Butanoate metabolism
    SAVERM_7309 (sdhB3)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAVERM_7309 (sdhB3)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAVERM_7309 (sdhB3)
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_17 Fer4_10 Fer4 Fer4_18 Fer4_2 Fer4_4 Fer4_16 Fer4_15 Fer4_21 Fer4_6 Fer2 Fer4_3 Fer4_22 Fer4_13
Other DBs
NCBI-ProteinID: BAC75020
NITE: SAV7309
UniProt: Q825Y4
Position
8717826..8718575
AA seq 249 aa
MKLTLRVWRQQNADADGAMSTYEVDDISADMSFLEMLDTLNEELILKGEDPVAFDHDCRE
GICGACSLVINGDAHGPERTTTCQLHMRSFEDGDTIDIEPWRASAFPVVKDLVVDRSAFD
RIIQAGGYITAPTGAAPEAHATAVPKPDADFAFEHAECIGCGACVAACPNGAAMLFTSAK
INHLNVLPQGAPERETRVLDMVTQMDEEGFGGCTLAGECATACPKGIPLVSITGMNKEWL
RATRKAAKR
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaagctcaccctgcgcgtctggcgccagcagaacgccgacgccgacggagcgatgtcc
acctacgaggtggacgacatctcggccgacatgtccttcctggagatgctcgacaccctc
aacgaggagctcatcctcaagggcgaggaccccgtcgccttcgaccacgactgccgcgag
ggcatctgcggcgcgtgctcgctcgtcatcaacggcgacgcccacggacccgagcgcacc
accacctgccagctccacatgcggtccttcgaggacggcgacaccatcgacatcgaaccg
tggcgcgcctcggccttcccggtcgtcaaggacctcgtcgtcgaccggtcggccttcgac
cggatcatccaggccggcggctacatcaccgccccgaccggcgccgcgcccgaggcccac
gccacggccgtgcccaagccggacgccgacttcgccttcgagcacgccgagtgcatcggc
tgcggcgcctgtgtggccgcctgcccgaacggcgcggcgatgctgttcacctcggccaag
atcaaccacctcaacgtgctgccgcagggcgcgcccgagcgcgagacccgcgtcctcgac
atggtgacccagatggacgaggagggcttcggtggctgcaccctcgccggagagtgcgcc
accgcctgcccgaagggcatcccgctggtctccatcaccggcatgaacaaggagtggctg
cgggcgactcgtaaggcggccaagcggtag

DBGET integrated database retrieval system