KEGG   Streptomyces avermitilis: SAVERM_3211
Entry
SAVERM_3211       CDS       T00126                                 
Symbol
xseA
Name
(GenBank) putative exoribonuclease large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    SAVERM_3211 (xseA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3211 (xseA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     SAVERM_3211 (xseA)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     SAVERM_3211 (xseA)
SSDB
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon Peptidase_S66 DUF2203 Rv2632c-like
Other DBs
NCBI-ProteinID: BAC70922
NITE: SAV3211
UniProt: Q82IE7
Position
4002836..4004044
AA seq 402 aa
MAANTSAETPLPVGEVSRLIGGWIDRLGAVWVEGQITQLSRRPGAGVVFMTLRDPSYDIS
VGVTCYRQVFDAVADVVSEGARVVVHAKPEWYAPRGQLSLRAAEIRPIGVGELLARLEQL
KKSLAGEGLFVTERKKALPFLPQLIGLVCGRASAAERDVLENARHRWPAVRFEVRNVAVQ
GVHAVPQVVQAVKELDARDDVDVIIVARGGGSVEDLLPFSDEQLVRAVAACRTPVVSAIG
HEPDTPLLDYVADLRASTPTDAAKKVVPDVGEEVERVRALRDRARRCVRSVIEREERGLA
HTLARPSIEDPHRMVDERADQVASLLDRGRRTLGHLLDRADSELSHTHARVVALSPAATL
KRGYAVLQRADGHAVRAPDEVTADEVLRARVAEGEFTVRVDV
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggctgcgaacacgtccgcggaaacgcctctgcccgtaggtgaggtgtcgcggctcatc
ggggggtggatcgaccggctcggcgcggtgtgggtcgaggggcagatcacccagctgtcg
cggcgcccgggcgcgggcgtcgtcttcatgaccctgcgcgacccgtcgtacgacatctcg
gtcggcgtcacctgctaccgacaggtgttcgacgcggtggcggacgtggtgagcgagggc
gcccgggtggtcgtacacgcgaagcccgagtggtacgcgccacgggggcagctgtcactg
cgggccgccgagatcaggcccatcggggtcggtgaactcctcgcccgtcttgagcagttg
aagaagagcctcgccggcgagggcctgttcgtcaccgagcgcaagaaggccctgcctttc
ctgccgcagctcatcgggctcgtgtgcgggcgcgcctcggcggccgagcgcgacgtcctg
gagaacgcgcggcaccgctggcccgccgtccgcttcgaggtgcgcaacgtggcggtgcag
ggcgtgcacgccgtgccgcaggtcgtccaggcggtgaaggagctggacgcgcgcgacgac
gtggacgtgatcatcgtcgcgcgcggcggcggcagcgtggaggacctgctgccgttctcc
gacgagcagctcgtccgagcggtggcggcctgccgtacgccggtcgtgtcggccatcggt
cacgaacccgacaccccgctcctcgactacgtggccgacctgcgcgcctccaccccgacc
gacgcggccaagaaggtcgtgccggacgtcggcgaggaggtcgagcgggtgcgggcgctg
cgggaccgggcgcggcggtgcgtgcggtcggtcatcgagcgggaggagcgggggctcgcg
cacacgctggcccgcccgtcgatagaggatccgcaccggatggtcgacgagcgggcggac
caggtcgcctccctgctcgaccgtggccggcgcacgctcggacatctgctggaccgcgcc
gattcggagctgtcgcacacccacgcgcgcgtggtggcactgtcaccggccgcgaccctg
aagcgggggtacgcggtgctccagcgagccgacggccatgcggtccgggcgccggacgag
gtgacggcggacgaggtgctgcgggcgcgggtcgccgagggtgagttcacggtacgagtc
gatgtttag

KEGG   Streptomyces avermitilis: SAVERM_3212
Entry
SAVERM_3212       CDS       T00126                                 
Symbol
xseB
Name
(GenBank) putative exoribonuclease small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    SAVERM_3212 (xseB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3212 (xseB)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     SAVERM_3212 (xseB)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     SAVERM_3212 (xseB)
SSDB
Motif
Pfam: Exonuc_VII_S
Other DBs
NCBI-ProteinID: BAC70923
NITE: SAV3212
UniProt: Q82IE6
Position
4004054..4004296
AA seq 80 aa
MTSRTDETANATALGYEQARDELIEVVRRLEAGGTTLEESLALWERGEELAKVCRTWLEG
ARKRLDAALAEEENAGDDSE
NT seq 243 nt   +upstreamnt  +downstreamnt
atgaccagcaggacggacgagacggcgaacgcgacggcgctcgggtacgagcaggcgcgg
gacgagttgatcgaggtcgtacgccgcctggaggcggggggcacgaccctggaggagtcg
ctcgccctgtgggagcggggcgaggagctggccaaggtgtgccggacctggctggagggc
gcgcgcaagcggctggacgcggcgctggcggaggaagagaacgcgggcgacgactcggaa
tga

DBGET integrated database retrieval system