KEGG   Streptomyces avermitilis: SAVERM_3393
Entry
SAVERM_3393       CDS       T00126                                 
Symbol
nagZ2
Name
(GenBank) putative beta-N-acetylhexosaminidase, secreted
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
sma00520  Amino sugar and nucleotide sugar metabolism
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_3393 (nagZ2)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SAVERM_3393 (nagZ2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_3393 (nagZ2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sma03110]
    SAVERM_3393 (nagZ2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SAVERM_3393 (nagZ2)
Chaperones and folding catalysts [BR:sma03110]
 Intramolecular chaperones
  Others
   SAVERM_3393 (nagZ2)
SSDB
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Other DBs
NCBI-ProteinID: BAC71105
NITE: SAV3393
UniProt: Q820G4
Position
complement(4214726..4216363)
AA seq 545 aa
MSGRRRRVPEGRTPVRRNRLLLGGGLIVAGTLGVTAVLWPSGGSEPAGARASTASSAAAA
TRTPSPSPTRAYPLSKAPRTIPAVREHTAARGPGWRPAKGGRVVVGDAALADEGKLTAGE
LGLAYAGRTGARAGDVELALDKGTGGPESYTLTVRGGRVRIAAPAEAGVFYGTRTLKQAV
HGGGTAPEGVVRDRPAKPRRGLMLDIARKHFTAGWIEDRIRELGDLKYNELGLHFSDDQG
FRIESASHPEIVSRQHLTKAEVRGIVDLAASRHIAVVPEIDSPGHLGAVIAAHPDLQLRN
ASGVPARGAVDISKPAAATIVDDLLNEYADLFPGAYWHLGGDEYQALMVSDPSASYPQLA
AAARNKYGANATVADLTTGWLNGRADNMRAHHRTMRAWNDGFYRSAGTVRPAKDIQVAYW
TGKEIGARQPAEYLSAGRKLINYNDEYLYYVLGQPQTFVYPTGQRIYQQWTPRVVRGSTA
VPARYDAQILGGVFAVWCDLAASQTQDQVAAGIRMPLRAMTQKLWDPRTPTLSWTEFRAL
ARQLG
NT seq 1638 nt   +upstreamnt  +downstreamnt
gtgagcggccgcaggcggcgcgtccccgaggggaggacgcccgtcaggcgcaacaggttg
ctgctgggtggcgggctgatcgtcgcgggcaccctcggggtgaccgccgtcctctggccc
tccggcggcagcgagccggccggtgcgcgggcgtccaccgcctcctcggccgccgccgcg
acccgtacgccctccccgtcaccgacccgcgcctaccccttgtcgaaggcaccgcgcacg
attcccgccgtacgggagcacacggccgcccgggggccgggctggcgtccggcgaagggc
ggccgggtcgtcgtgggcgacgcggcactggccgacgagggcaagctgaccgcgggcgag
ctggggctggcgtacgcgggccggaccggtgcccgggcgggagacgtggagctggcgctc
gacaagggcaccggtggcccggagtcgtacaccctgaccgtgcggggcggccgggtgcgg
atagccgcccccgccgaggcgggcgtcttctacggcacccgcaccctcaagcaggcggtg
cacggcggcggtacggcgcccgagggcgtcgtacgcgaccggccggccaagccccgacgc
ggcctcatgctcgacatcgcgcgcaagcacttcacggcgggctggatcgaggaccgcata
cgggaactgggcgacctcaagtacaacgagctgggcctgcacttctccgacgaccagggc
ttccgtatcgagtcggcctcgcatccggagatcgtgtcccggcagcacctgaccaaggcg
gaggtccgcgggatcgtcgacctggcggcgagccggcacatcgccgtcgtgcccgagatc
gactcgcccggtcacctgggcgcggtgatcgccgcgcaccccgacctccagctgcgcaac
gcctcgggggtccccgcgcgcggggccgtcgacatctccaagcccgccgccgcgaccatc
gtcgacgacctgctgaacgagtacgccgatctgttccccggcgcgtactggcacctcggc
ggcgacgagtaccaggcgctgatggtgtccgatccgtcggcctcctatccgcagctcgcc
gcggccgcccggaacaagtacggggcgaacgccaccgtcgcggacctcacgaccggctgg
ctcaacggccgcgccgacaacatgcgcgcgcaccaccggacgatgcgggcgtggaacgac
ggcttctaccggtcggccggcacggtccggccggccaaggacatccaggtcgcctactgg
accggcaaggagatcggcgcccggcagccggccgagtacctgagcgcgggccgcaagctc
atcaactacaacgacgagtacctctactacgtgctcggccagccgcagaccttcgtctac
ccgacggggcagcggatctaccagcagtggaccccgcgcgtcgtgcgcggcagcacggcc
gtccccgcgcggtacgacgcccagatcctcggcggggtcttcgcggtgtggtgcgacctc
gcggcctcgcagacccaggaccaggtcgccgccgggatccggatgccgctgcgggcgatg
acccagaagctgtgggatccgcggacgccgacgctgtcctggacggagttccgggcgctg
gcgaggcagttgggctga

KEGG   Streptomyces avermitilis: SAVERM_5134
Entry
SAVERM_5134       CDS       T00126                                 
Symbol
nagZ3
Name
(GenBank) putative beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
sma00520  Amino sugar and nucleotide sugar metabolism
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_5134 (nagZ3)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SAVERM_5134 (nagZ3)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_5134 (nagZ3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sma03110]
    SAVERM_5134 (nagZ3)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SAVERM_5134 (nagZ3)
Chaperones and folding catalysts [BR:sma03110]
 Intramolecular chaperones
  Others
   SAVERM_5134 (nagZ3)
SSDB
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Other DBs
NCBI-ProteinID: BAC72846
NITE: SAV5134
UniProt: Q82D50
Position
6233930..6235663
AA seq 577 aa
MTDVTDVMALIPAPRHVGACGEGFFELGPDTRLAAGAGTERTARWLRGTIGAATGFPLAP
GDGGIRLSVHPTVTRDLGEEGYRLAVTPDAVHLVGGGPAGLFWGAQTLRQLLGPGAHRRA
PLPGGQWRLPLTHIQDSPRFPWRGVMLDVSRHFMPKDGVLRHLDLMAAHKLNVFHFHLTD
DQGWRIEIKRYPKLTEVGSWRARTKFGHRASQRWEEKPHGGFYTQDDIREIVAYAAERHI
TVVPEIDIPGHSQAAIAAYPELGNSDVIDTTSLTVWDDWGVSKNVLAPTDNTLRFYEGVF
EELLELFPADAAAFSAFVHIGGDECAKDQWKQSPAVQARIEELGLTGEDALQAWFVRHFG
TWLAARGRRLIGWDEILEGGSRAAGTRAEATRAAGTRAPGGETADIGLPEGAAVSSWRGY
QGGITAARAGHDVVMCPEQQVYLDHRQDGGADEPVPIGYVRTLEDVYRFEPVPPQLTEDE
ARHVLGTQANLWTEVMEDHARVDYQAFPRLAAFAEVAWSALPAPAERDFADFERRMTAHY
GRLDALGVAYRPPTGPLPWQRRPGVLGRPIEGPPPNA
NT seq 1734 nt   +upstreamnt  +downstreamnt
gtgaccgacgtgaccgacgtgatggcactgattcccgcgccccggcacgtgggggcgtgc
ggcgaaggcttcttcgagttgggcccggacacccggctggcggcgggtgccgggaccgaa
cggaccgcgcgatggctgcgcggcacgatcggggcggccaccggcttcccgctcgcaccg
ggcgacggcgggatcaggctgtccgtccacccgacggtgaccagggacctcggcgaggag
ggctaccggctcgcggtcacgccggacgcggtgcacctggtcggcggcggccccgccggg
ctcttctggggcgcccagaccctgcggcagctgctcggtcccggcgcccaccggcgggcg
ccgctgcccggcgggcagtggcggctgccgctgacgcacattcaggattcgccccggttc
ccctggcgcggcgtcatgctcgacgtctcccggcacttcatgcccaaggacggcgtcctg
cgccacctggatctgatggccgcccacaaactcaacgtcttccacttccacctcaccgac
gaccagggctggcgcatcgagatcaagcggtacccgaagctcacggaggtcggatcctgg
cgggcgcgcaccaaattcggccaccgcgcttcacaacggtgggaggagaagccgcacggc
ggcttctacacgcaggacgacatccgcgagatcgtcgcctacgcggccgagcggcacatc
accgtcgtccccgagatcgatatcccgggccactcgcaggccgccatcgccgcgtatccg
gaactcggcaactccgacgtcatcgacacgacctccctgacggtctgggacgactggggc
gtctccaaaaacgtactcgcccccactgacaacaccctgcgcttctacgagggcgtgttc
gaggaactcctggagctgttcccggccgacgccgccgcgttctcggccttcgtccacatc
ggcggcgacgagtgcgccaaggaccagtggaagcagtcgcccgccgtccaggcccgcatc
gaggagctggggctcacgggcgaggacgcgctccaggcgtggttcgtccggcacttcggc
acctggctcgccgcgcgcgggcgccggctcatcggctgggacgagatcctggagggcggg
agccgcgccgcagggacacgtgccgaagcgacacgcgccgcagggacacgcgcgcccgga
ggtgagacggcggacatcggcctcccggaaggggccgccgtctcctcgtggcgcggctac
cagggcggcatcacggccgcccgcgcgggccacgacgtcgtcatgtgccccgaacagcag
gtctacttggaccaccgccaggacggcggcgcggacgagccggtgcccatcgggtacgtg
cgcaccctggaggacgtctaccgcttcgagcccgttccgccgcagctcaccgaggacgag
gcgcgccatgtgctgggcacccaggccaatctgtggaccgaggtgatggaggaccacgca
cgcgtggactaccaggcgttcccgcggctcgcggccttcgccgaggtcgcctggagcgcg
ctgcccgcccccgccgaacgggacttcgccgacttcgagcggcggatgaccgcccactac
ggacggctcgacgccctgggagtggcctaccgcccgcccacgggaccgctgccctggcag
cggcggccgggtgtgctcggacgcccgatcgaggggccgcccccgaacgcgtag

KEGG   Streptomyces avermitilis: SAVERM_5268
Entry
SAVERM_5268       CDS       T00126                                 
Symbol
nagZ4
Name
(GenBank) beta-N-acetylhexosaminidase, secreted
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
sma00520  Amino sugar and nucleotide sugar metabolism
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_5268 (nagZ4)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SAVERM_5268 (nagZ4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_5268 (nagZ4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sma03110]
    SAVERM_5268 (nagZ4)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SAVERM_5268 (nagZ4)
Chaperones and folding catalysts [BR:sma03110]
 Intramolecular chaperones
  Others
   SAVERM_5268 (nagZ4)
SSDB
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Other DBs
NCBI-ProteinID: BAC72980
NITE: SAV5268
UniProt: Q82CS0
Position
6381542..6383131
AA seq 529 aa
MRQHHRTPRLLGTLLLVAAAGFSVAGSAPAAAAKTASPLGQVVPAPASVDPGGSPYRITR
DTRIRVDDSREVRQVGEYLAGILRPSTGYRLPVASQGGGGIRLRLGERSLGDEGYRLDSG
RNGVTITAAAPAGLFHGVQTLRQLLPAAVEKNSVQPGPWLVAGGTIKDTPRYGYRGAMLD
VSRHFFDVGQVKRYIDELALYKVNKLHLHLSDDQGWRIALDDWPRLTTYGGSTQVGGGRG
GFYTKAQYTEIVRYAASRHLEVVPEIDMPGHTNAALASYAELNCDGTAPPLYTGTDVGFS
SLCVGKPVTYDFVDDVIRELAALTPGRYLHIGGDEAHSTSHADYVAFMDKVQPVVAKYGK
TVIGWHQLTGATPAKGALAQYWGLDDTSAAEKAQVVKAAQNGTGLVLSPADRIYLDMKYT
ADTPLGQDWAGLVEVRRAYDWDPGTYLAGAPGASIRGVEAPLWTETIVTGADIDYMVFPR
LPGVAELGWSPASTHDWDTYKVRLAAQGPRWEARGIRYYRSPQVPWPGA
NT seq 1590 nt   +upstreamnt  +downstreamnt
gtgagacagcaccacagaacgccccgtcttctcggcacgctgctgctcgtggcggctgcc
ggcttctccgtcgccggctcggcgcccgccgcggccgcgaagacggcgagcccgctcggc
caggtcgttccggcccccgcctcggtcgacccgggcggatcgccgtaccgcatcacccgg
gacacccgcatccgtgtggacgactcgcgggaggtacgacaggtcggcgagtacctcgcg
ggcatcctgcggccctccaccggttaccggctgccggtcgcctcccagggcggcggaggc
atccggctccggctgggcgaacgctcgctgggcgacgagggataccgcctcgacagcggc
aggaacggcgtcaccatcaccgccgccgcaccggccgggctcttccacggcgtgcagacc
ctgcgccagctcctcccggccgcggtcgagaagaactccgtacagcccggaccctggctc
gtcgcgggcggcaccatcaaggacaccccgcgctacggctaccgcggcgcgatgctcgac
gtgtcccggcacttcttcgacgtcggccaggtcaagcgctacatcgacgagttggcgctg
tacaaggtcaacaagctgcatctgcacctctccgacgaccagggctggcgcatcgcgctc
gacgactggccgcggctcaccacctacggcggatcgacgcaggtgggcggcggccgaggc
ggcttctacacgaaggcccagtacacggagatcgtgcggtacgcggcctcccgccatctg
gaggtcgtcccggagatcgacatgccgggccacaccaacgcggccctcgcctcctacgct
gagctgaactgcgacggcaccgcgccgccgctctacaccggcaccgacgtcggcttcagc
tcgctgtgcgtgggcaagccggtgacgtacgacttcgtggacgacgtcatccgtgagctg
gccgcgctcacacccggccgctatctccacatcggcggtgacgaggcccactccaccagc
cacgccgactatgtggccttcatggacaaggtgcagcccgtcgtcgccaagtacggcaag
acggtgatcggctggcatcagctgaccggggcgaccccggcgaagggcgcgctcgcccag
tactgggggctcgacgacaccagcgccgcggagaaggcgcaggtcgtgaaggccgcgcag
aacgggacggggctggtcctctcgccggccgaccggatctacctcgacatgaagtacacc
gcggacaccccgctcgggcaggactgggcgggtctggtcgaggtgcggcgggcgtacgac
tgggatccgggcacctacctcgccggagcccccggcgcgtcgatcaggggcgtcgaggcg
ccgctgtggacggagacgatcgtcaccggcgcggacatcgactacatggtcttcccgcgg
ctgcccggcgtcgccgaactcggctggtcgcccgcgtcgacccacgactgggacacgtac
aaggtgcggctcgcggcgcaggggccgcggtgggaggcgcgggggatccggtactaccgg
tccccccaggttccctggcccggtgcgtag

DBGET integrated database retrieval system