KEGG   Streptomyces avermitilis: SAVERM_3436
Entry
SAVERM_3436       CDS       T00126                                 

Symbol
mdh
Name
(GenBank) putative malate/lactate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00270  Cysteine and methionine metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00012  Glyoxylate cycle
sma_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3436 (mdh)
   00620 Pyruvate metabolism
    SAVERM_3436 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_3436 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_3436 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_3436 (mdh)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SAVERM_3436 (mdh)
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N Stealth_CR1
Other DBs
NCBI-ProteinID: BAC71148
NITE: SAV3436
UniProt: Q82HS2
Position
complement(4259507..4260496)
AA seq 329 aa
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALKAAEGTAMELDD
CAFPLLQGIDITDDPNVAFDGTNVGLLVGARPRTKGMERGDLLSANGGIFKPQGKAINDN
AADDVKILVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSTVADIK
RLTIWGNHSATQYPDIFHASVAGKNAAEVVNDEKWLAEDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVYTWVNGTADGDWTSMGIPSDGSYGVPEGLISSFPVTTKDGRYEIVQGLE
INEFSRARIDASVKELEEEREAVRALGLI
NT seq 990 nt   +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtcaagctgcgt
ctcctggagatcaccccggcgctcaaggccgccgagggcacggcgatggagctcgacgac
tgcgccttcccgctccttcagggcatcgacatcacggacgacccgaacgtcgccttcgac
ggcaccaacgtcggtctgctcgtcggcgcccgcccccgcaccaagggcatggagcgcggc
gacctgctctccgccaacggcggcatcttcaagccgcagggcaaggccatcaacgacaac
gccgcggacgacgtcaagatcctcgtcgtcggcaacccggcgaacaccaacgcgctcatc
gcgcaggccgccgccccggacgtaccggccgagcgcttcaccgcgatgacccgtctggac
cacaaccgtgcgctgacccagctcgcgaagaagacgggcagcacggtcgccgacatcaag
cgtctgacgatctggggcaaccactccgccacccagtacccggacatcttccacgcctcg
gtcgccggcaagaacgccgccgaggtcgtgaacgacgagaagtggctggccgaggacttc
atcccgacggtcgccaagcgcggcgccgcgatcatcgaggcccgtggcgcgtcctccgcc
gcgtcggccgccaacgccgccatcgaccacgtgtacacctgggtcaacggcaccgcggac
ggcgactggacctccatgggcatcccgtcggacggttcctacggcgtcccggagggcctc
atctcctccttcccggtcaccaccaaggacggccggtacgagatcgtccagggcctggag
atcaacgagttctcccgcgcccgcatcgacgcctccgtcaaggagctcgaggaggagcgc
gaggcggtccgcgccctcggcctcatctga

DBGET integrated database retrieval system