KEGG   Streptomyces avermitilis: SAVERM_3442
Entry
SAVERM_3442       CDS       T00126                                 
Symbol
folD1
Name
(GenBank) putative methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_3442 (folD1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SAVERM_3442 (folD1)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SAVERM_3442 (folD1)
SSDB
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH Hydrolase
Other DBs
NCBI-ProteinID: BAC71154
NITE: SAV3442
UniProt: Q82HR6
Position
complement(4265904..4266758)
AA seq 284 aa
MTAQILDGKATAAAIKSDLTARVAALKEKGVTPGLGTILVGDDPGSQKYVAGKHRDCAQV
GIASIQRELPATATQEEIEAAVRELNEDPACTGYIVQLPLPKGIDENRILELMDPDKDAD
GLHPMNLGRLVLNEPAPLPCTPNGVLTLLRRYGVEIKGAEVVVVGRGVTIGRPMPLLLTR
RSENATVTQCHTGTRDLSSHLKRADIIVAAAGSAHLIRPEDVKPGAAVLDVGVSRSAEGK
IVGDVHPGVAEVAGWISPNPGGVGPMTRAQLLVNVVEAAERSVG
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaccgcccagattctcgatggcaaggccaccgcagccgcgatcaagtccgatctgacc
gcccgcgtggcggccctcaaggaaaagggtgtgacgcccggcctcggcacgatcctcgtc
ggggacgaccccggcagccagaagtacgtcgcgggcaagcaccgcgactgcgcccaggtc
ggcatcgcctccatccagcgggagctgcccgcgaccgccacgcaggaggagatcgaggcg
gccgtacgcgagctgaacgaggacccggcctgcaccggctacatcgtccagctgccgctg
cccaagggcatcgacgagaaccgcatcctggagctgatggacccggacaaggacgcggac
ggcctgcacccgatgaacctcggccgcctcgtcctgaacgagccggcccccctgccctgc
accccgaacggcgtcctcaccctgctccgccgctacggcgtggagatcaagggcgcggag
gtcgtggtcgtcggccgcggcgtgaccatcgggcgtccgatgccgttgctgctgacgcgg
cgcagcgagaacgcgacggtcacgcagtgccacaccggtacgcgcgacctctcctcgcac
ctcaagcgcgccgacatcatcgtcgccgcggcgggttccgcgcacctgatccggcccgag
gacgtgaagccgggcgcggccgtgctcgacgtcggtgtctcgcgcagcgccgagggcaag
atcgtcggcgatgtccaccccggtgtcgccgaggtggccggctggatctccccgaacccg
ggcggcgtcggcccgatgacccgcgcccagctgctcgtcaatgtggtcgaggcggcggag
cgcagtgtcggctga

KEGG   Streptomyces avermitilis: SAVERM_543
Entry
SAVERM_543        CDS       T00126                                 
Symbol
folD2
Name
(GenBank) putative methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_543 (folD2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SAVERM_543 (folD2)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SAVERM_543 (folD2)
SSDB
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Other DBs
NCBI-ProteinID: BAC68253
NITE: SAV0543
UniProt: Q82QG3
Position
complement(687276..688139)
AA seq 287 aa
MSATQTAQLMDGTGHARRIVEEAAAKAAEISQRTGTAPCLATVLVGDDPASVTYVRMKRA
RCAKAGIRSRHIALPATTTTAELIDSLSGLSGDPEVHGILLQHPCGPHIDERAAFEAIAP
AKDVDGVTMHSFAAMSFGLPGFVSCTPGGIMRLLEAYDVDLAGKHAVVVGRSAILGKPVG
MLLLAKDATVTYCHSRTADLSAMVREADVVVAAVGRPRLIRGEDIKPGAVVIDAGYNPGN
VGDVDFDAVLTRARLITPVPGGVGPMTIAVLLEQTVDAAANQLGVQQ
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtccgcgactcagacggcccagctcatggacggcaccggccatgcccggcgcatcgtc
gaagaggctgctgccaaagcggccgagatctcacagcgcacgggtactgccccctgtctg
gcgacggtgctggtgggagatgaccccgcatcggtcacttatgtccgcatgaagcgggca
cggtgcgcaaaggcaggtatccggtctcgacacatcgctctgcctgctaccaccacgacc
gctgagctgatcgacagtctctctgggctgtccggcgatccggaggtgcacggcatcctt
ctccagcatccttgcggcccgcacatcgatgagcgcgcggcgttcgaggccatcgccccg
gcgaaagatgtcgacggggtcacgatgcattccttcgccgcaatgagctttggcctgccg
ggcttcgtatcctgcaccccgggcggaatcatgcggctgctggaggcgtacgacgtcgac
ctcgccggcaagcacgccgtcgtggtggggcgcagcgcgattctcggcaaaccggtgggg
atgctcctgctcgccaaggacgcaacggtgacctactgccactcccgcacggcagaccta
tcggcgatggtccgggaagcggacgtcgtggtagcggccgtgggacggccccggctcatc
cgcggtgaggacatcaagcccggcgcggtggtgatcgacgccggatacaacccgggcaac
gtcggcgacgtggacttcgacgccgttctcacccgtgcccgtctgatcactccggtgcct
ggcggcgtaggaccgatgaccatcgccgtcctgctcgaacagaccgtggacgccgccgcg
aaccagctcggagtccagcagtga

DBGET integrated database retrieval system