KEGG   Streptomyces avermitilis: SAVERM_3444
Entry
SAVERM_3444       CDS       T00126                                 
Symbol
purH
Name
(GenBank) putative bifunctional purine biosynthesis protein
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
sma  Streptomyces avermitilis
Pathway
sma00230  Purine metabolism
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_3444 (purH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_3444 (purH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_3444 (purH)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     SAVERM_3444 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     SAVERM_3444 (purH)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_3444 (purH)
SSDB
Motif
Pfam: AICARFT_IMPCHas MGS
Other DBs
NCBI-ProteinID: BAC71156
NITE: SAV3444
UniProt: Q82HR4
Position
complement(4267834..4269417)
AA seq 527 aa
MTAEGTVTAEGTQRPIRRALISVYDKTGLEDLARGLHEAGVELVSTGSTAAKIAAAGVPV
TKVEELTGFPECLDGRVKTLHPKVHAGILADLRLDEHRRQLEELGVEPFQLVVVNLYPFR
ETVASGASPDECVEQIDIGGPSMVRAAAKNHPSVAVVTSPERYADVLSAVRGGGFDLTAR
KRLAAEAFRHTAAYDVAVASWFASSYAPVDESVFPDFLGATFERKSTLRYGENPHQPAAL
YVDGGGTGLAEAEQLHGKEMSYNNYTDTDAARRAAYDHAEPCVAIIKHANPCGIAIGADV
AEAHRKAHACDPLSAFGGVIAVNRPVSKELAEQVAEIFTEVIVAPGYEDGALEALAKKKN
IRVLRAQDAPANPAELKQIDGGALLQVTDRLQADGDDPANWTLATGEALSPAELDELAFA
WRACRAVKSNAILLAKDGASVGVGMGQVNRVDSAKLAVERAGEERARGAFAASDAFFPFP
DGLEILTAAGVRAVVQPGGSVRDELVVEAAKKAGVTMYFTGTRHFFH
NT seq 1584 nt   +upstreamnt  +downstreamnt
gtgaccgccgaaggtaccgtgaccgccgagggcacgcagcgcccgatcaggcgcgcgctc
atcagcgtctacgacaagacggggctcgaagacctcgcccgcggcctgcacgaggccggt
gtcgagctcgtctccaccggctccaccgccgcgaagatcgccgcggccggcgtcccggtc
accaaggtcgaggagctgaccggcttccccgagtgcctggacggccgcgtcaagacgctg
catcccaaggtccacgcgggcatcctcgccgacctgcggctcgacgagcaccggcgtcag
ctcgaggaactgggcgtggaaccgttccagctcgtcgtcgtgaacctctacccgttccgc
gagaccgtcgcctccggcgcctccccggacgagtgcgtcgagcagatcgacatcggcggc
ccgtccatggtccgtgccgccgccaagaaccacccgtccgtggccgtggtcaccagcccc
gagcggtacgccgacgtcctctccgcggtccgcggcggcggcttcgacctcaccgcccgc
aagcggctcgccgccgaggccttccggcacaccgcggcgtacgacgtcgccgtcgcctcc
tggttcgcgtcctcgtacgcccccgtcgacgagtccgtcttcccggacttcctcggtgcc
accttcgagcgcaagagcaccctgcgctacggcgagaacccgcaccagcccgccgccctc
tacgtcgacggcggcggcaccggcctcgccgaggccgagcagctgcacggcaaggagatg
tcgtacaacaactacacggacacggacgccgcgcgccgtgccgcgtacgaccacgccgag
ccctgcgtcgcgatcatcaagcacgccaacccctgcggcatcgcgatcggcgcggacgtc
gccgaggcgcaccgcaaggcgcacgcctgcgacccgctgtccgcgttcggcggtgtgatc
gcggtcaaccgcccggtgtccaaggagctggccgagcaggtcgcggagatcttcaccgag
gtcatcgtcgcgcccggttacgaggacggcgcgctggaggccctcgccaagaagaagaac
atccgcgtgctgcgggcccaggacgctccggccaacccggccgagctcaagcagatcgac
ggcggcgcgctgctccaggtcaccgaccgtctccaggccgacggcgacgacccggcgaac
tggaccctggccaccggcgaggccctgtcgcccgccgagctggacgagctggccttcgcc
tggcgagcgtgccgcgcggtgaagtccaacgcgatcctgctcgccaaggacggtgcctcg
gtgggtgtcggcatgggtcaggtcaaccgggtcgactccgcgaagctggcggtcgagcgg
gcgggcgaggagcgtgcccgtggtgcgttcgccgcgtcggacgcgttcttcccgttcccc
gacggcctggagatcctcaccgcggcgggcgtcagggccgtggtccagcccggcggttcg
gtccgtgacgaactggtcgtggaggccgcgaagaaggcgggcgtgacgatgtacttcacg
ggcacgcgccacttcttccactag

DBGET integrated database retrieval system