KEGG   Streptomyces avermitilis: SAVERM_3549
Entry
SAVERM_3549       CDS       T00126                                 
Symbol
mfd
Name
(GenBank) putative transcriptional-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:5.6.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SAVERM_3549 (mfd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3549 (mfd)
Enzymes [BR:sma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     SAVERM_3549 (mfd)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      SAVERM_3549 (mfd)
SSDB
Motif
Pfam: CarD_CdnL_TRCF TRCF UvrB_inter DEAD Helicase_C ResIII AAA_22 Glyco_tran_WecG RecG_dom3_C
Other DBs
NCBI-ProteinID: BAC71261
NITE: SAV3549
UniProt: Q82HG0
Position
complement(4390621..4394151)
AA seq 1176 aa
MSLHGLLDAVAKDAALAEAVQAATDGNRMHVDLVGPPAARPFTVAALARDTGRTVLAVTA
TGREAEDLAAALRSLLPPDRVVEYPSWETLPHERLSPRSDTVGRRLAVLRRLAHPRADDP
ETGPVSVVVAPIRSVLQPQVKGLGDLEPVALRTGQTADLGTIVEALSAAAYARVELVEKR
GEFAVRGGILDVFPPTEEHPLRVEFWGDDVEEIRYFKVADQRSLEVAEHGLWAPPCRELL
LTDDVRERAAALAEAHPELGELLGKIAEGIAVEGMESLAPVLVDDMELLIDVLPKGSMAV
VCDPERVRTRAADLVATSQEFLQASWAATAGGGEAPIDVDAASLWAIADVRDRARELEMM
WWSVSPFAADDELDADTLKLGMHAPESYRGDTAKALADTKGWLADGWRTVYVTEGHGPAA
RTVEVLGGEGIAARLDPDLAEISPSLVHVACGSIDYGFVDPRLGLAVLTETDLSGQRSVS
KDGARMPARRRKTIDPLTLEAGDYIVHEQHGVGRYIEMVQRTVQGATREYLVVEYAPAKR
GQPGDRLYIPTDQLEQITKYVGGEAPTLHRLGGADWTKTKARAKKAVKEIAADLIKLYSA
RMAAPGHAFGSDTPWQRELEDAFPYAETPDQLTTIAEVKEDMEKTVPMDRLICGDVGYGK
TEIAVRAAFKAVQDGKQVAVLVPTTLLVQQHFGTFGDRYSQFPVNVRALSRFQTDTEAKA
TLEGLREGSVDVVIGTHRLFSSETKFKDLGLVIVDEEQRFGVEHKEQLKKLRANVDVLTM
SATPIPRTLEMAVTGIREMSTITTPPEERHPVLTFVGPYEERQIGAAIRRELLREGQVFY
IHNRVESIDRAAARLREIVPEARIATAHGQMSEQTLEQVVVDFWEKKYDVLVSTTIVESG
IDISNANTLIVERGDNFGLSQLHQLRGRVGRGRERGYAYFLYPPEKPLTETAHERLATIA
QHTEMGAGMYVAMKDLEIRGAGNLLGGEQSGHIAGVGFDLYVRMVGEAVADYRASLEGGV
EEEPPLEVKIELPVDAHVPHDYAPGERLRLQAYRAIASVNTEEDIKSVREELVDRYGKLP
EPVENLLLVAGLRMHARACGVGEIVLQGNNIRFAPVELRESQELRLKRLYPGTVIKPAAH
QVLVPRPKTAKVGGKPLVGRELLGWTGEFLTTILGS
NT seq 3531 nt   +upstreamnt  +downstreamnt
atgagcctgcacggtctgctcgacgccgtcgccaaggacgccgcactcgccgaagcggtg
caggccgccaccgacggcaaccgcatgcacgtcgacctggtcggacctccggccgcgcgc
cccttcaccgtcgccgcgctcgcccgggacaccggccgtacggtcctcgcggtgacggcg
accggacgggaggccgaggacctggcggcggccctgcgctccctgctcccgccggaccgc
gtcgtggagtacccgtcgtgggagacgcttccgcacgagcggctgagcccgcgcagcgac
accgtcggacgccgtctcgccgtgctgcgccgcctcgcccacccgcgcgccgacgacccc
gagaccggcccggtctcggtcgtcgtggcgccgatccgctccgtgctccagccgcaggtc
aagggcctgggcgacctggagccggtggcgctgcgcacagggcagacggccgacctcggc
acgatcgtggaggcgctgtccgcggccgcgtacgcgcgggtcgagctggtcgagaagcgc
ggcgagttcgccgtacgaggcggcatcctcgacgtgttcccgcccaccgaggagcacccg
ctgcgcgtggagttctggggcgacgacgtcgaggagatccgttacttcaaggtcgccgac
cagcggtccctcgaagtcgccgagcacggcctgtgggcgccgccctgccgcgagctgctg
ctcacggacgacgtacgggagcgggccgccgccctggccgaggcccacccggagctgggc
gagctgctcggcaagatcgccgagggcatcgccgtggagggcatggagtccctggcgccc
gtcctcgtcgacgacatggaactgctcatcgacgtcctgccgaagggctcgatggccgtc
gtgtgcgacccggagcgggtgcggacgcgggcggccgacctggtggccaccagtcaggag
ttcctccaggcgtcctgggccgcgaccgcgggcggcggcgaggcccccatcgacgtcgac
gcggcctccctgtgggccatcgcggacgtccgggaccgggcccgcgagctggagatgatg
tggtggtcggtgtcgccgttcgccgcggacgacgaactcgacgcggacaccctgaagctc
ggcatgcacgcccccgagagctaccgcggcgacaccgcgaaggcgctggccgacaccaag
ggctggctcgcggacggctggcgcacggtgtacgtcaccgagggccacggcccggcggcc
cgtacggtcgaggtgctgggcggcgagggcatcgcggcccgcctggacccggacctggcc
gagatcagcccctccctcgtgcacgtcgcctgcggctccatcgactacggcttcgtggat
ccgcggctcggactcgctgtcctcaccgagacggacctctccggccagcgctcggtgtcc
aaggacggcgcgcgcatgccggcccggcgccgcaagaccatcgacccgctgaccctcgaa
gcgggcgactacatcgtccacgagcagcacggcgtcggccgctacatcgagatggtgcag
cggaccgtgcagggcgcgacccgcgagtatctggtggtggagtacgcgccggccaagcgc
ggccagcccggcgaccgcctctacatcccgaccgaccagctggagcagatcaccaagtac
gtcggcggcgaggcccccaccctgcaccgcctgggcggcgcggactggacgaagaccaag
gcgcgcgccaagaaggcggtcaaggagatcgcggcggacctgatcaagctgtacagcgcg
cgcatggcggctcccgggcacgcgttcggttcggacacgccgtggcagcgcgagctggag
gacgcgttcccgtacgcggagacccccgaccagctgacgacgatcgccgaggtcaaggag
gacatggagaagacggtcccgatggaccgcctgatctgcggcgacgtgggttacggcaag
acggagatcgcggtccgggcggccttcaaggcggtgcaggacggcaagcaggtcgcggtc
ctcgtcccgacgacgctgctggtgcagcagcacttcgggacgttcggcgaccgctactcg
cagttcccggtgaacgtccgcgcgctgtcccgcttccagacggacacggaggccaaggcc
accctggagggcctgcgcgagggctcggtggacgtcgtcatcggtacccaccgcctgttc
tcgtcggagacgaagttcaaggacctgggcctggtcatcgtcgacgaggagcagcgcttc
ggcgtcgagcacaaggagcagctgaagaagctgcgcgcgaacgtcgacgtcctcacgatg
tcggccacccccatcccccgtacgttggagatggcggtcacgggcatccgcgagatgtcc
acgatcaccaccccgccggaggagcggcacccggtgctgaccttcgtgggcccgtacgag
gagcggcagatcggcgcggccatccgccgcgaactgctgcgcgagggccaggtcttctac
atccacaaccgggtggagtcgatcgaccgggccgcggcgaggctgcgcgagatcgtcccc
gaggcccgtatcgccacggcccacggccagatgtcggaacagacgctggagcaggtggtc
gtcgacttctgggagaagaagtacgacgtgctcgtgtccacgacgatcgtggaatcgggc
atcgacatctcgaacgcgaacacgctgatcgtggagcgcggcgacaacttcggcctgtca
cagctgcaccagctgcgaggccgggtgggccgaggccgtgagcggggctacgcgtacttc
ctctacccgccggagaagccgctgacggagacggcccacgaacgcctggccaccatcgcc
cagcacacggagatgggcgcgggcatgtacgtggcgatgaaggacctggagatccgcggc
gcgggcaatctgctcggcggcgagcagtcgggccacatcgcgggcgtcggcttcgacctg
tacgtacgcatggtcggcgaggcggtcgcggactaccgcgcgtcgctggagggcggcgtg
gaggaggagccgccgctcgaggtcaagatcgaactgccggtcgacgcacacgtcccgcac
gactacgcgccgggcgagcggctgcggctccaggcctaccgggcgatcgcctccgtgaac
acggaggaggacatcaagtccgtacgggaggaactcgtcgaccgctacggcaagttgccc
gagccggtggagaacctgctcctggtcgcgggcctgcgcatgcacgcgcgcgcgtgcggg
gtcggcgagatcgtgctccagggcaacaacatccgcttcgcgccggtggagctgcgggag
tcgcaggaactgaggctgaagcggctgtaccccggcacggtcatcaagccggccgcgcac
caggtgctggtgccgcgccccaagacggcgaaggtgggcgggaagccgctggtcgggcgg
gaactgctgggctggaccggggagttcttgactacgatccttggctcgtag

DBGET integrated database retrieval system