KEGG   Streptomyces avermitilis: SAVERM_3592
Entry
SAVERM_3592       CDS       T00126                                 
Name
(GenBank) putative integral membrane protein
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
sma  Streptomyces avermitilis
Pathway
sma00514  Other types of O-glycan biosynthesis
sma00515  Mannose type O-glycan biosynthesis
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    SAVERM_3592
   00514 Other types of O-glycan biosynthesis
    SAVERM_3592
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sma01003]
    SAVERM_3592
Enzymes [BR:sma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     SAVERM_3592
Glycosyltransferases [BR:sma01003]
 O-Glycan biosynthesis
  O-linked Man type
   SAVERM_3592
SSDB
Motif
Pfam: PMT_4TMC PMT PMT_2
Other DBs
NCBI-ProteinID: BAC71304
NITE: SAV3592
UniProt: Q82HB8
Position
4445895..4447634
AA seq 579 aa
MTSTASSTDIRQGQAADEQWPSWQQRLRRFGYTAPPRTDVRDRLVPPFSEPSPRLWAAIG
LRQEVADRVTRWSAWGGPLLVTLLAGLLRFWNLGSPKAVIFDETYYAKDAWALIHNGYEA
NWAKDANDLILQGNGHVAIPTDPAYVVHPPVGKYVIGLGEWLFGFTPFGWRFMTALLGTL
SVLLLCRIGRRLFRSTFLGCLAGALMAVDGLHFVMSRTSLLDGVLMFFVLAAFGCLVVDR
DRARARLAAALPADADGVVRPDAHTAETTRLGPRPWRWLAGLMLGLALGTKWNALYVMAA
FCVMAVLWDVGSRRVAGARRPYAAVLRRDTGITFLATVPVAVATYLVSWTGWILSPANGS
GGYFRNWAATDGKGGHWTWLPDWLRSLWHYEHEVYEFHVGLSSPHQYQSNPWSWLVAGRP
VSYFYESPSPGKDGCPADAGEKCAREVLALGTPLLWWAACFAVLYVLWRWLFRRDWRAGA
IACGIAAGWLPWMMYQERTIFYFYAVVFVPFLCLAVAMMIGAILGPPGSGERRRVVGAAG
AGVLVLLIAWNFIYFWPLYTGTAIPIDDWRSRMWLDTWV
NT seq 1740 nt   +upstreamnt  +downstreamnt
gtgaccagtaccgcgtcctccacggacatccggcagggccaggccgccgacgagcagtgg
ccgtcgtggcagcagcggctgcgccgcttcggatacacggcgccgccgagaaccgacgtg
cgcgaccggctggtgccgccgttcagcgagcccagcccacggctgtgggcggcgatcggc
ctgcgccaggaggtcgcggaccgtgtgacgcgctggtcggcgtggggcggcccgctgctc
gtgacgctgctggcgggcctgctgcgcttctggaacctgggcagccccaaggcggtgata
ttcgacgagacgtactacgccaaggacgcctgggcgctcatccacaacgggtacgaggcg
aactgggccaaggacgccaacgacctgatcctccagggcaacggccatgtggcgatcccg
acggaccccgcctatgtggtgcaccccccggtcggcaagtacgtcatcggcctcggcgaa
tggctgttcgggttcaccccgttcggctggcgcttcatgacggcgctgctcggcacgctc
tccgtcctgctgctgtgccgcatcggccgccgtctgttccgctcgacgttcctcggctgc
ctggcgggcgcgctgatggcggtggacggcctgcacttcgtgatgagccgcacctcgctg
ctcgacggggtgctgatgttcttcgtgctggccgcgttcggctgtctggtcgtcgaccgg
gacagggcgcgcgcccggctggcggcggcgctcccggccgacgcggacggtgtcgtacgc
ccggacgcgcacaccgccgagacgacccgcctcggcccgcgcccgtggcgctggctggcc
ggcctgatgctgggcctggccctgggcaccaagtggaacgcgctctacgtcatggccgcg
ttctgtgtgatggcggtcctttgggacgtcggctcccgccgcgtcgcgggcgcccgccgc
ccgtacgcggccgtgctccggcgcgacacgggcatcacgttcctggcgacggtcccggtg
gccgtggccacctacctggtctcctggacgggctggatcctctccccggccaacggcagc
ggcggctacttccgcaactgggccgcgaccgacggcaagggcggccactggacctggctc
ccggactggctgcgcagcctgtggcactacgagcacgaggtgtacgagttccacgtaggc
ctctcgtctccgcaccagtaccagtcgaacccctggagctggctggtcgccggccgcccg
gtctcgtacttctacgagtccccgtcgcccggcaaggacggctgtcccgccgacgcgggc
gagaagtgcgcccgcgaggtcctcgccctcggcaccccgctgctgtggtgggcggcctgc
ttcgcggtcctgtacgtcctgtggcgctggctcttccgccgcgactggcgggcgggcgcg
atcgcctgcggaatcgcggccggctggctgccgtggatgatgtaccaggaacgcacgatc
ttctacttctacgcggtcgtcttcgtcccgttcctgtgcctggcggtggccatgatgatc
ggcgcgatcctggggccgcccggctcgggcgaacgccgccgggtggtgggcgcggcgggc
gcgggcgtcctggtcctcctgatcgcctggaacttcatctacttctggcccctgtacacg
ggcacggcgatcccgatcgacgactggcggtcgcggatgtggctggatacgtgggtctag

DBGET integrated database retrieval system