KEGG   Streptomyces avermitilis: SAVERM_3671
Entry
SAVERM_3671       CDS       T00126                                 
Symbol
moaC
Name
(GenBank) putative molybdenum cofactor biosynthesis protein
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00790  Folate biosynthesis
sma01100  Metabolic pathways
sma01240  Biosynthesis of cofactors
sma04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAVERM_3671 (moaC)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAVERM_3671 (moaC)
Enzymes [BR:sma01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     SAVERM_3671 (moaC)
SSDB
Motif
Pfam: MoaC
Other DBs
NCBI-ProteinID: BAC71383
NITE: SAV3671
UniProt: Q82H75
Position
complement(4545387..4545899)
AA seq 170 aa
MTVPSRGETPGPPAQDRLTHIDEAGAARMVDVSGKDVTARTARASGRVLVSPRVVELLRG
EGVPKGDALATARIAGIMGAKRTPDLIPLCHPLSVSGVKLDLSVADDAVEILATVKTTDR
TGVEMEALTAVSVAALTVIDMVKAVDKGAVITDVRVEEKTGGKSGDWSRS
NT seq 513 nt   +upstreamnt  +downstreamnt
atgactgttccatcccggggggagacccccggaccccctgcgcaggaccggctgacgcac
atcgacgaggcgggcgccgcccgcatggtcgacgtgtccgggaaggacgtgaccgcgcgc
accgcccgcgccagcggccgcgtcctcgtctcaccgcgcgtcgtcgaactgctgcgcggc
gagggagtccccaagggggacgccctcgccaccgcgcgcatcgcggggatcatgggcgcc
aagcgcaccccggacctcatcccgctgtgccacccgttgtcggtgtcgggtgtcaagctt
gatctgtcggtcgcggacgacgccgtggagatcctggccaccgtgaagacgacggatcgc
acgggcgtcgagatggaggccctgaccgcggtctccgtcgccgcgctcaccgtgatcgac
atggtcaaggcggtcgacaagggggcggtcatcacggacgtacgcgtggaggagaagacg
ggcggcaagtcgggcgactggagcaggtcatga

DBGET integrated database retrieval system