KEGG   Streptomyces avermitilis: SAVERM_3674
Entry
SAVERM_3674       CDS       T00126                                 
Name
(GenBank) putative ligase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_3674
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     SAVERM_3674
SSDB
Motif
Pfam: 5-FTHF_cyc-lig
Other DBs
NCBI-ProteinID: BAC71386
NITE: SAV3674
UniProt: Q82H72
Position
4548308..4548931
AA seq 207 aa
MSHLRPGSDPDKRMLRREFLVVRSRLTADDVRETASALAARALELPELAHARTVAAYVSV
GSEPGTLALLDALHARGVRVLLPVLLADNDLDWGAYAGQGSLARVRHGGKMALLEPAGTR
LGPSAVLGADAVLLPGLAVDSRGMRLGRGGGSYDRVLARLERAGVDPALVVLLYDTEVVD
RVPEEPHDRPVHAAVTPSGVRRFRAAS
NT seq 624 nt   +upstreamnt  +downstreamnt
gtgagtcacctgaggcccggctctgatcctgacaagcgaatgttgcggcgagagttcctt
gtggtgagaagccggttgacggcggatgacgtgcgggaaacggcgtccgctctcgcggcc
cgggccctggaactgccggagctggcgcacgcgcgcacggtggcggcgtacgtctccgtg
gggagcgagccgggcaccctcgcgctcctggacgcgctgcacgcgcgcggggtgcgcgtg
ctgctgccggtcctcctggcggacaacgatctcgactggggtgcgtacgccggacagggc
tcactcgcccgcgtccggcacggcgggaagatggccctcctggagccggcgggcacccgg
ctgggcccgtctgccgtgctcggcgccgacgccgtcctgctgcccggcctcgcggtggac
tcccgggggatgcgcctgggccgcggcgggggctcgtacgaccgggtactggcccgcctg
gagcgcgcgggcgtggatccggccctggtggtgctgctgtacgacacggaggtcgtggac
cgcgtaccggaggagccgcacgaccggccggtgcacgcggcggtgacgccgtcgggggtg
cgccgctttcgggccgcgtcctga

DBGET integrated database retrieval system