KEGG   Streptomyces avermitilis: SAVERM_3806
Entry
SAVERM_3806       CDS       T00126                                 

Symbol
fadD16
Name
(GenBank) putative acyl-CoA synthetase, fatty acid:CoA ligase
  KO
K18687  HIP---CoA ligase [EC:6.2.1.41]
Organism
sma  Streptomyces avermitilis
Pathway
sma00984  Steroid degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SAVERM_3806 (fadD16)
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.41  3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoate---CoA ligase
     SAVERM_3806 (fadD16)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C HTH_41
Other DBs
NCBI-ProteinID: BAC71518
NITE: SAV3806
UniProt: Q82GU0
Position
complement(4708540..4710123)
AA seq 527 aa
MRGDVEWGSIPGLVRSSAERYADTEAVVEGRTRISYAELGARVERAAAACIASGVGVGDR
VGIWAPNSLDWIVSALGAVSAGAVLVPLNTRFKGSEAAYVLRRSGARLLFVTGTFLGTSY
VASLRRAAGEGEGLRGPLPGLPALEQVVVLADDAPADFRTWKDFLASGEGVGEAETRERA
RGLDGSTVSDIIFTSGTTGRPKGAVITHAQTLRAYEVWSDLAGLRRGDRYLIANPFFHTF
GYKAGVIACLMRGATMIPQPVFNVDTVLANIAAERVSVLPGPPTLHQSLLDHPARDAYDL
SALRLVVTGAAVVPLRLVERLRGELGVGTVLTAYGLSEASGIVTMCRRGDDPSVIASTSG
RAIPGTEVRVEAPLGSPGEVLVRGFNVMRGYFEDERATAAALTEDGWLRTGDVGVLDASG
NLRITDRIKDMFIVGGFNAYPAEIEQLLGLHPDVADVAVIGVPDARLGEVGKAYVVRRPG
SVLTGDDLIAWSRREMANYKVPRAVEFVGELPRNAGGKVVKGELRGR
NT seq 1584 nt   +upstreamnt  +downstreamnt
gtgcgcggagacgtggagtggggcagcatcccgggcctggtgcggtcgtccgcggagcgg
tacgcggataccgaggcggtggtggagggccgtacgaggatctcgtacgccgagttgggc
gcccgggtggagcgtgcggcggcggcgtgtatcgccagcggggtgggtgtcggcgaccgg
gtgggcatctgggcgccgaattcgctggactggatcgtctcggcgctgggcgcggtgtcg
gcgggcgcggtactggtgccgctgaacacgcgcttcaaggggagcgaggcggcttatgtt
ctgcggcggagcggggcgcggttgctgttcgtgaccgggacgtttctgggcacgtcgtac
gtggcttcgctgcggcgggcggcgggggagggcgaggggctccgtggtcccctgcccggg
cttcccgccctggagcaggtggtggtgctggcggacgacgcgccggccgacttccgtacg
tggaaggacttcctggcgagcggggagggggtgggcgaggcggagacgcgggagcgagcg
cgggggctggacggctcgacggtctcggacatcatcttcacgtcgggtacgacgggccgc
ccgaagggcgcggtgatcacgcacgcgcagacgttgcgggcgtacgaggtgtggagcgac
ctggcgggcctgcgccggggtgaccgctacctgatcgcgaaccccttcttccacaccttc
ggctacaaggcgggagtgatcgcctgcttgatgcgaggcgcgacgatgatcccgcagccg
gtgttcaacgtggacacggtgctggcgaacatcgccgcggaacgggtctccgtactaccg
ggcccgcctaccctgcaccagtccctgctggaccatccggcccgggacgcgtacgacctg
tcggcgctgcggctggtggtgaccggggcggcggtggtgccgttgcggctggtggagcgg
ttgcggggggagttgggggtgggaaccgtgctcacggcgtacggcctctcggaggccagc
ggcatcgtcacgatgtgccgtcggggcgacgatccgtccgtgatcgcgtcgacgtcgggg
cgcgcgattcccggtacggaggtccgtgtggaggcgccgctcggctcccccggggaggtc
ctggtccgcggcttcaacgtgatgcggggctacttcgaggacgagcgggccacggcggcg
gcgctgacggaggacggctggctcaggacgggcgacgtgggcgtcctggacgcgtccggc
aatctccggatcacggaccggatcaaggacatgttcatcgtcggcggcttcaacgcctac
cccgccgagatagagcaactgctcggcctgcacccggatgtggcggacgtggcggtgatc
ggcgtaccggacgcacgcctcggcgaggtgggcaaggcgtacgtggtccgccgcccgggt
tccgtcctgacgggggacgacctgatcgcctggtcccggcgcgagatggcgaactacaag
gtgccgcgggcggtggagttcgtgggggagctgccgcggaacgctggcgggaaggtggtg
aagggggagttgcgggggcggtga

DBGET integrated database retrieval system